(data stored in ACNUC1104 zone)

EMBL: CP001966.PE259

CP001966.PE259       Location/Qualifiers
FT   CDS_pept        271984..273735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0263"
FT                   /product="conjugal transfer protein"
FT                   /note="KEGG: cms:CMS_2699 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76913"
FT                   /db_xref="GOA:D5UQT0"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT0"
FT                   /inference="similar to AA sequence:KEGG:CMS_2699"
FT                   /protein_id="ADG76913.1"
FT                   /translation="MDRATRGPVIVSGLLAVAAFAVLVVPSIISSGKGPAVLMLLGGVL
FT                   VLVGGLVAVVRMQRSSAGGGASSPVTCKIDDCAQYMPSHREVEQFTAKAVKKTALRLSR
FT                   DGFDPKNPATWGLDLGTLVPTRHALMLDFESCIFVVAGMRRGKSQAFAIPWTLDGPGAV
FT                   IVTSNKIDVYRETSVLRRRAGHREWLFDLQDLTGSGAPEIRFDPFEMITDLETAMQAAG
FT                   HFVSSVQKKGATAHSYFDNAGVRILAAYMLAASLIGGDLLHVARWLDKPRETLAAEILI
FT                   EYGFSDLGSQVKARNQLDPRQQEGFFDPARMFIEAVVNPKFARWVVPEERGVIARHPET
FT                   GKHIVKDVKDSRPVFKAAEFVRSTDTLYALSQHGEGSPAPLVTALVGIVIETARTVANR
FT                   EQGGRLKRPIIAILDEVANICRLKGLPNMMSYCGSIGVVLAPILQSKTQGENIWGDEFT
FT                   AAWNSANAVAYLGGNRDDELEREISARIGDQDKTRENKSYSSGSTNYSENTSREPIMPP
FT                   ELVGELPKGRGILLASGCRPVVIAPSMAYQSKRAGEIDAAKKEYDASHRVRANDLEDNT
FT                   EGERKAA"
     atggataggg cgacacgcgg accggtgatc gtctccgggc tgctcgcggt ggccgcgttc        60
     gcggtgctgg tggtgccctc gatcatctcg agcggcaagg gcccggcggt gctgatgctg       120
     ctcggcggtg tcctcgtcct ggtgggcggg ctggtggcgg tggtgcggat gcagcgcagc       180
     agcgccggcg ggggtgcgtc atcgccggta acctgcaaga tcgacgactg cgcgcaatac       240
     atgccctcgc accgtgaggt cgagcagttc accgcgaaag cggtgaaaaa gaccgcgttg       300
     cggctgagtc gcgacgggtt cgatccgaag aatccggcga cgtggggcct ggatttgggg       360
     acgctggttc ctacgcggca tgcgctgatg ctcgacttcg aatcgtgcat cttcgtcgtc       420
     gccggcatgc ggcgaggcaa gagccaggcg ttcgcgatcc cctggacgtt ggacgggcca       480
     ggtgcggtga tcgtgacctc gaacaagatc gacgtgtacc gggaaacgag tgtgttgcgc       540
     cggcgtgccg ggcaccggga gtggctgttc gatctgcagg atctgaccgg atctggtgca       600
     ccggagatcc ggtttgatcc gtttgagatg atcaccgact tggagacggc gatgcaggcg       660
     gcggggcatt tcgtgtcgtc ggtgcagaag aagggcgcca cggcgcacag ctacttcgac       720
     aacgcgggcg tgcggattct cgccgcgtac atgctcgccg catcgctgat cggtggggat       780
     ctgctgcacg tagcgcggtg gttggacaaa ccgcgcgaaa cgttggctgc ggagatcctc       840
     atcgagtacg ggttctccga tctcggttcg caggtcaagg cacgtaatca gctcgatcca       900
     cggcagcagg aaggcttctt cgacccggct cgcatgttca tcgaggccgt ggtgaacccg       960
     aagttcgccc gctgggtcgt gcccgaagag cgcggggtca tcgcccggca tccagagacg      1020
     ggcaagcaca tcgtcaagga cgtgaaggat tcgcggccag tgttcaaggc cgcagagttc      1080
     gtgcgctcca cggacacgct gtacgcgctg tcgcagcacg gcgaaggctc acccgcacca      1140
     ctggtaaccg cactggtcgg catcgtgatc gagaccgccc gcaccgtggc aaaccgggag      1200
     cagggcggtc gcctcaagcg gccgatcatc gcgatcctcg acgaggtcgc caacatctgc      1260
     cggctcaaag gcctgccgaa catgatgagc tactgcggat cgatcggcgt ggtcctcgcg      1320
     ccgatcctgc agagcaagac ccaaggggag aacatctggg gcgatgagtt caccgcggca      1380
     tggaactcgg cgaacgcggt cgcctacctg ggcggtaacc gtgacgacga gctcgaacgg      1440
     gaaatctccg cccgcatcgg cgaccaggac aagacccggg agaacaagtc ctacagctcc      1500
     gggagcacca actacagcga gaacaccagc cgcgagccga tcatgccgcc cgagctggtg      1560
     ggcgagctac ccaagggccg cgggatcctc ctcgcctccg gctgccggcc ggtcgtcatc      1620
     gccccgtcca tggcctacca atccaagcgt gccggcgaaa tcgacgccgc gaagaaggaa      1680
     tacgacgcct cccaccgagt gcgcgccaac gacctcgaag acaacaccga aggcgagagg      1740
     aaagcagcat ga                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page