(data stored in ACNUC1104 zone)

EMBL: CP001966.PE263

CP001966.PE263       Location/Qualifiers
FT   CDS_pept        275927..277090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0267"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   art:Arth_1766 transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76917"
FT                   /db_xref="GOA:D5UQT4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT4"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76917.1"
FT                   /translation="MTAAPAVGQEPIIVGIDTHKETHHAAILSARGKFLADRKFPATAL
FT                   GYSQLLTWTATVGTVAAFGIECTGSYGAGLLRHLLAEGHDVREVNRPHAHTAARRGKTD
FT                   AIDAEAAARKVLAGEAPVVPKDTTGAVESIRMLTLARNSAVKARSTAQTQLQNVLITAP
FT                   HTLREQINSDVSGPKARVAACSRLRPNISRLNEPAQAAKLTLRSLAQRVESLDDEIATL
FT                   DRELGQLVAATTPTLVSKLGIGTGHAAQFLISAGGLTPCSWTRVIQHMAGGSENPRMAR
FT                   KSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVDKLGSGTRTASAAAGVSV
FT                   GRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFAGETSW"
     atgacagcag caccggccgt cgggcaagag ccgatcattg tcggcattga cacccacaaa        60
     gagacacacc acgctgcgat cctgagcgcg cgaggaaaat tcctcgccga caggaagttt       120
     ccagccacgg ctctcggata ctcgcagctg ctgacctgga ctgcgactgt cggcacggtg       180
     gctgcattcg gtatcgagtg caccggctcc tacggcgccg gcctccttcg tcaccttctg       240
     gcggagggcc acgatgtgcg tgaggtcaac cgcccgcacg cgcataccgc tgctcggcgc       300
     ggtaagactg atgcgatcga cgccgaggcc gcggcgcgta aggttctagc cggtgaggcg       360
     cctgtggtgc cgaaggacac cacaggtgcg gtggagtcga tccggatgct caccttggcc       420
     agaaattccg cggttaaggc ccgatcgact gcgcagaccc agttgcagaa cgtgctcatc       480
     accgctccgc acacgctgcg cgagcagatc aacagcgatg tctccggacc gaaggctcgc       540
     gtcgcggcat gtagtcgtct gcgtcctaat atttcgaggc tcaacgagcc ggctcaggcc       600
     gcgaaactga ccttgcgcag cctcgcgcag cgtgtggaga gcctggacga cgagatcgct       660
     actcttgacc gcgaacttgg gcagctcgtc gccgcgacca ctcccacgct ggtctccaag       720
     ctcggaatcg gcaccgggca cgcggcacag ttcctcatca gtgcaggggg ccttaccccc       780
     tgttcttgga cacgtgtaat ccagcacatg gctgggggaa gtgagaatcc aaggatggcc       840
     aggaagagtt acaccgatga gttccggtgc cgggcggtgg acttgtatga gtcgacgccg       900
     ggtgcgacgt tgcaggggat cgcggcggat ttgggtgtgt cccggggatc gttgaagggg       960
     tgggtcgaca agctcggctc cgggacgagg accgcgtcgg ctgcggcggg ggtgtcagtg      1020
     gggcggcggg agtcgcaggc ggcgaggatc acgaggctgg aggccgagaa tggggtgttg      1080
     cgggtcgagc aggcaaagct tgctgaggaa cgcgacattc tccgtcaggc ggcgaagtat      1140
     ttcgccgggg agacgagttg gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page