(data stored in ACNUC1104 zone)

EMBL: CP001966.PE267

CP001966.PE267       Location/Qualifiers
FT   CDS_pept        complement(280680..281588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0272"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76921"
FT                   /db_xref="GOA:D5UQT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76921.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYRATLTQAA"
     gtgaaccgct tccagttcgt tgaggaccac aaggacgcct acggcgtgaa gcggttgtgc        60
     caggtgattg ggatcgcgcg gtcgtcgttc tacgcgtggc tcgctgcagc gcaggggcgg       120
     gccgcgcgga cggcggctga ctcggtgctg gcgggccgga tccgggtgct gcaagacccg       180
     aaacagggcg gggatcgtgc ttacggagcg cctcggatca ccgctgacct caacgccggc       240
     gcagccgaga gtgagcgggt caaccacaag cgcgtggcgc gcgtgatgcg tgagcacggc       300
     ctggccggaa tccggctccg caagcgtgtg aagacaaccg tcccggatca gtccggtcga       360
     cgcttcccag atctgatcgg caggaacttc agcaccggcg gtcctggtcg ccgctacgtc       420
     ggcgacatca cctacctgcc catcgccgac ggcagcaacc tctacctcgc gtcggtcatc       480
     gacctgggct cacgcaagct ggcaggctgg tcgatggcca ctcacatgcg caccgagctc       540
     gtcgaaaacg cactacgggc cgcgcagcgc gaacgcggca ccctggctgg ggcgatcttt       600
     cactccgacc acgggtcggt ctacacctcg aaggcctaca ccgccctctg cgagcacttc       660
     ggcgtgaccc agtcgatggg agcgatcggc tcgtccgcgg acaacgccct cgctgagagc       720
     ttcaacgcga ccctcaaacg cgaactcctc caaggccgac cagcgttcgg cgaccaggcc       780
     acggcctacc gggccgtgtt ccggtgggcc aaccgctaca acacccgccg ccggcactcc       840
     gcgatcggca acatcacacc aaacacctac gaaaccgcct accgcgctac gctcacgcaa       900
     gcggcataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page