(data stored in ACNUC1104 zone)

EMBL: CP001966.PE27

CP001966.PE27        Location/Qualifiers
FT   CDS_pept        complement(26548..28542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0027"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: rer:RER_00280 serine/threonine protein kinase
FT                   PknB; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76681"
FT                   /db_xref="GOA:D5UPC9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76681.1"
FT                   /translation="MTTPPRRINDRYDLGETLGFGGMSEVHLARDTRLSRDVAIKILRA
FT                   DLARDPSFYERFRREAQNAASLNHPTIVQVYDTGEADTPGGPLPYIVMEYVDGETLRDV
FT                   LRRDGTIAPQAAMTWMADVCAALDFSHRNGIVHRDMKPANVMLTRTGEIKVMDFGIARA
FT                   MSDPSAGMTQTAAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLTGQPPFQGDSP
FT                   VSVAYQHVREDPPTPSSILDTVPPELDSITLKALSKNPANRYQTAGEMRQDLIRVLAGR
FT                   KPEAPMVLSDEERDALLTEPTKPRRAAKAAPAAAAAAAAVPAAAAGTPGEPTGDDDRPT
FT                   EAVATVPAASGRAKHSTASGGRSRLVLWISAAIIAIILVGGTTAYLLAGPDEAKQVTVP
FT                   SQIGQNASDAQVALQKLGFNVQIKRVPDNTVPAEQVISTIPGPDSQATEGSTVIVEVSS
FT                   GPKIAAVPDVVNRSEKDARDILTKAGFTVAKDPKKEASPTVKAGDVVSTNPAVGANTPQ
FT                   NTPIVLTVSTGKEQVRVPDVSNTALSQAEANLKGLGFTTKVQEVDDPAPAGTVLRTTPA
FT                   GGTTADKGSDITIVVSKAKAVVMPNLVGQDPSAAKAALIAMGFSESNIQVMATAPSNLP
FT                   WDKNKVWKTTPDAGARVDTSASITIEVRR"
     atgacaaccc cgccgcgtcg catcaacgac cgctatgacc tgggcgaaac gctcgggttc        60
     ggtggcatgt ccgaggtgca cctggcgcgg gacacccggc tgtcgcggga cgtggcgatc       120
     aagatcctgc gcgcggatct ggcgcgggat ccgagcttct acgagcggtt ccggcgcgaa       180
     gcgcagaacg cggcctcgct gaatcatccg acgatcgtgc aggtgtacga cacgggcgag       240
     gcggacactc ccggcgggcc cctgccgtac atcgtgatgg agtacgtcga cggcgagacg       300
     ctgcgcgatg tgctgcgtcg cgacggcacc atcgccccgc aggcggcgat gacctggatg       360
     gccgatgtgt gtgcggcgct ggacttcagc caccgcaacg ggatcgtgca ccgcgatatg       420
     aagccggcca acgtgatgct cacccgcacc ggcgagatca aggtgatgga cttcggcatc       480
     gcccgcgcga tgagcgatcc gtcggcgggg atgacgcaga cggccgctgt gatcggcacc       540
     gcgcagtacc tctcgcccga gcaggcgcgg ggggagtccg tcgatgcccg ctcggatgtg       600
     tacgcggccg gctgcgtgtt gttcgagctg ctcaccggac agccgccgtt ccagggtgat       660
     tcaccggtgt cggtggccta ccagcacgtg cgggaggacc cgcccactcc gtcgtcgatc       720
     ctggacacgg tgccgcccga gctggactcg atcacgctca aggcgctgtc gaagaacccg       780
     gcgaatcggt accagaccgc cggtgagatg cggcaggacc tgatccgggt gctcgcgggg       840
     cgtaagcccg aggcgccgat ggtgctcagc gacgaggagc gcgatgcgct gctcaccgag       900
     cccacgaagc cccgtcgggc cgcgaaggcc gctcccgcag ccgccgcggc cgcggcagcc       960
     gttcccgcgg ccgccgccgg gacgccgggt gaaccgaccg gcgacgacga ccggcccacg      1020
     gaggccgtgg ccaccgtgcc ggcggcgagc ggccgggcga agcactccac cgcttcgggc      1080
     ggccgctcga ggctggtgct gtggatctcg gccgcgatca tcgcgatcat cctggtgggc      1140
     ggcaccacgg cgtacctgct ggccgggccc gatgaggcga agcaggtgac cgtcccctcg      1200
     cagatcggac agaacgccag cgacgcgcag gtcgcgctgc agaagctcgg cttcaacgtg      1260
     cagatcaagc gcgtccccga taacacggtg cccgccgagc aggtgatctc cacgatcccc      1320
     ggcccggatt cgcaggccac cgaggggtcg acggtgatcg tcgaggtttc gtcgggtccg      1380
     aagatcgcgg ccgtgcccga tgtggtgaac cgctcggaga aggatgcccg cgacatcctc      1440
     accaaggccg gattcaccgt cgcgaaggac ccgaagaagg aggcctcgcc cacggtgaag      1500
     gcgggcgatg tggtctccac gaaccccgca gtcggcgcca acaccccgca gaacacgccg      1560
     atcgtgctca ccgtcagcac cggcaaggag caggtccggg tcccggatgt gtccaacacg      1620
     gcgctctcgc aggcggaggc gaatctcaag ggcctgggct tcaccaccaa ggttcaggag      1680
     gtcgacgatc ccgcacccgc gggcacggtg ctccgcacca cccccgcggg cggaaccacc      1740
     gccgataagg gcagcgacat caccatcgtc gtgtccaagg cgaaggccgt cgtgatgccg      1800
     aacctggtcg gccaggatcc gagcgcggcg aaggcggcgc tcatcgcgat gggcttctcc      1860
     gagagcaata tccaggtgat ggccacggca ccgtcgaacc tgccgtggga caagaacaag      1920
     gtctggaaga ccacgccgga tgcgggggcg cgcgtggaca cctccgcctc gatcaccatc      1980
     gaggtccgcc gctag                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page