(data stored in ACNUC1104 zone)

EMBL: CP001966.PE270

CP001966.PE270       Location/Qualifiers
FT   CDS_pept        complement(283780..285885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_4254 kinetoplast DNA-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76924"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76924.1"
FT                   /translation="MTVCRALINPASANLRGLYVALTRGKAENHAYTATPATIDEHTED
FT                   QHLHGAGDERAADNSRAILAVVLAKDDGHKAAVEHIQEALAASTDPQTARDAYTAARDL
FT                   LVADYTDHLLAAHLPAAIVATIDADPAGKARIRSVVDQLIASGASSTVIGARLNAVHDG
FT                   LETARNLPAFIAYKINPPASAVAAQEHRAARELFVRDYTDHLLATHLPAAVVATIDADP
FT                   DSRRSIENAVDRLHAAGATDIPARFADADTRLENLSPGASYTAHLLRSLRRPTHANEQA
FT                   DPSPAQIAAHLHADPAGNAQLNAALTALAPLPDLTPEPDPADLPALPPAHPGADRSLRE
FT                   HAHHAVDSHDRATADQLAIDRPADTEPEAAQPVAAALTTEQLLAAETTPALAPGLDPAT
FT                   LAAAARAVDEATRGPDTEPATEPAETAPDTEAPADPAAAERKALAARTVAEFKQHSIRR
FT                   LPASELDYIARTGGRKHADRLRELRHHTPREVAEHEASAQRLALYERSYAREQPYRDAI
FT                   TAHRKAIDALDTARTKRDAVARELADTGRLSPRRRELARELDTRTAAVTAAEKAAEDAR
FT                   RTRSQEQARAGKHPVTDGALQAAREHTENARAEAEKAQARQQAKIAELTATITARQQAA
FT                   LTEQERRSQLDPTQLKIEQKLRGAALEHAQQQAQQRKDAARARAGRFANDPARPVSRGV
FT                   DGPTRGR"
     gtgaccgtct gccgcgcact gatcaacccg gcctcggcga acctacgcgg cctctacgtc        60
     gccttgaccc gcggcaaggc cgaaaaccac gcctacaccg ccacccccgc caccatcgac       120
     gaacacaccg aagaccagca cctgcacggc gccggcgacg agagggccgc cgataacagt       180
     cgcgcgatcc tcgcagtcgt cctcgccaag gacgacgggc ataaggccgc ggtcgagcac       240
     atccaagagg ccctcgccgc gtccactgac ccgcagaccg cgcgggacgc ctacaccgcc       300
     gcccgcgatc ttctggtggc tgattacacc gaccacctcc tcgccgcgca tctgcccgcc       360
     gcgatcgtcg cgaccatcga cgccgacccc gccgggaagg ctcgcatccg ctccgtggtc       420
     gaccagctca tcgcatcagg cgctagcagc acagttatcg gcgcgcgact caatgccgtg       480
     catgacgggc tggagaccgc acggaacctg cccgctttca tcgcctacaa gatcaaccca       540
     cccgccagcg cagtcgccgc acaagagcac cgtgcggcgc gtgagctgtt cgtccgggat       600
     tacaccgacc acctcctcgc cacccacctg cccgccgcgg tcgtggcgac catcgacgcc       660
     gaccccgata gccgacgatc catcgaaaat gcggtggacc ggctgcacgc tgccggagcc       720
     accgacatcc cggcccgctt cgccgacgcc gacacccggc tcgagaacct ctctcccggc       780
     gccagctaca ccgcacacct gctgcgcagt ctccgacgtc ccacccacgc aaacgaacag       840
     gccgatccga gccccgcaca gatcgccgcc cacctacacg ccgaccccgc cggcaacgcg       900
     caactgaacg ccgccctgac cgcactcgca cccctacccg acctcacccc cgagccggat       960
     ccggcggatc tgcctgcact gcccccggcg catcccggcg ccgaccgcag cctgcgcgaa      1020
     cacgcccacc acgccgtcga cagccacgac cgcgccaccg ccgaccagct cgctatcgac      1080
     agacctgccg acaccgagcc cgaggcggcg caaccagtcg ccgcagcgct caccaccgag      1140
     cagctgctcg ctgccgaaac caccccggct ctcgctccgg ggctggaccc ggccaccctc      1200
     gccgcggccg cccgcgccgt cgatgaggcg acccgcggcc ccgataccga gccggccaca      1260
     gaacctgccg agaccgcccc cgacaccgag gcacccgccg acccggccgc tgccgaacgc      1320
     aaggccctcg ccgcgcgcac cgtggccgag ttcaagcagc actccatccg ccggctcccc      1380
     gccagcgaac tcgactacat cgctcgcacc ggcggccgca aacacgccga ccgtctccgc      1440
     gaactgcgcc accacacacc ccgcgaagtc gccgaacacg aagcctccgc gcaaaggctc      1500
     gccctctacg agcgcagcta cgcccgtgag cagccctacc gcgacgccat caccgcccac      1560
     cgcaaagcga tcgatgccct cgacaccgcc cgaacaaagc gcgacgccgt ggcccgcgag      1620
     ctcgccgaca ccggacggct ctcaccgcgc cgccgcgaac tcgcccgcga actcgacacc      1680
     cgcacagccg cggtcaccgc cgccgagaag gcagccgaag acgcacgccg cacccgttcc      1740
     caagaacagg cccgcgccgg caagcacccc gtcaccgacg gcgctctgca agccgcgcgc      1800
     gagcacaccg aaaacgctcg cgccgaagcc gagaaggccc aagcccgcca gcaggccaag      1860
     attgccgaac tcaccgccac catcaccgcc cgccagcaag ccgccctcac cgaacaagag      1920
     cgccgcagcc aactcgaccc gacccagctc aaaattgaac agaagctacg cggggccgcg      1980
     ctcgaacacg ctcagcagca ggcgcaacag cgcaaggacg ctgcgcgtgc ccgcgccggt      2040
     cggttcgcca acgaccccgc ccgccccgtc agtaggggcg tagacggccc gacacgcggt      2100
     cgatag                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page