(data stored in ACNUC1104 zone)

EMBL: CP001966.PE276

CP001966.PE276       Location/Qualifiers
FT   CDS_pept        complement(290280..290714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0282"
FT                   /product="protein of unknown function UCP032285"
FT                   /note="PFAM: protein of unknown function UCP032285; KEGG:
FT                   cgb:cg1510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76930"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU7"
FT                   /inference="protein motif:PFAM:PF08877"
FT                   /protein_id="ADG76930.1"
FT                   /translation="MGFSAFRVWASKFGLTVSVEPEAQNSDYESGVAQIAGREWHVRTA
FT                   RNTPTKPGAFVAFWRRGMDGQTLPFSVERLDAGLLVFVESEGRRGVFKFSASHLAELGI
FT                   ASASDRGGKRGFRVYPSWCEGLNPQARATQRAQAPAFDEY"
     gtgggattca gcgcgttccg ggtctgggcg tccaagttcg gcttgaccgt ttcggtggag        60
     cccgaggcgc agaacagtga ctacgagtcg ggtgtggcgc agattgcggg ccgcgagtgg       120
     cacgtccgga ccgctcggaa cacgccgaca aagccaggcg ccttcgtcgc cttttggcgg       180
     cggggtatgg acgggcagac gctgccgttc agcgtcgagc ggctcgatgc tgggctattg       240
     gtgtttgtgg agagcgaagg tcggcgcggc gttttcaagt tctccgccag ccatcttgcg       300
     gagttgggga ttgcctcggc gagtgaccgt gggggcaagc gcggctttcg cgtgtacccg       360
     tcttggtgtg aaggtttaaa cccgcaggcc agggctacgc aacgcgcgca ggcgcccgca       420
     tttgacgagt actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page