(data stored in ACNUC1104 zone)

EMBL: CP001966.PE278

CP001966.PE278       Location/Qualifiers
FT   CDS_pept        293552..293983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0285"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rsa:RSal33209_0055 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76932"
FT                   /db_xref="GOA:D5UQU9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76932.1"
FT                   /translation="MPEADSSDHDLGLDITIAALRFLRDTRNGAPVSPEQLSLLTTLAC
FT                   NGAPVGLKELASIEKINRSTLTGFLNLLEQSGLVIRCPHPYDSRRVTARITSYGYEVID
FT                   QCKKYYGDQLRKMDVTSRRLIQLCARLHPQMLDLARFEE"
     ttgcctgaag cggatagttc agaccacgat ctcggcctag atataacaat cgcagcattg        60
     agatttttgc gcgatacgag gaacggcgca ccggtgagcc ctgaacagtt atccctgctg       120
     acaaccctcg cctgcaatgg agcgcccgtt ggacttaaag aactagccag catcgagaag       180
     attaaccgtt caactttaac cggatttcta aacttgctag aacagtctgg acttgtaatt       240
     cgttgcccgc atccgtatga ctcgagaagg gttacagcgc gaataacctc ctacggctat       300
     gaagtaattg atcaatgcaa aaagtactat ggtgatcagc tccggaagat ggatgtcaca       360
     agccggcggt tgatccaact ctgcgcaaga ctgcaccctc agatgctcga tctcgccaga       420
     tttgaggaat ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page