(data stored in ACNUC1104 zone)

EMBL: CP001966.PE28

CP001966.PE28        Location/Qualifiers
FT   CDS_pept        complement(28563..29957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0028"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: nfa:nfa810 putative serine/threonine protein
FT                   kinase; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76682"
FT                   /db_xref="GOA:D5UPD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76682.1"
FT                   /translation="MSLQTGSIIADRYELLRLIATGGMGQVWEAMDTRLDRRVAIKVLK
FT                   AEFSEDQEFLARFRNEARTTAALNHPGIAGVYDYGETQDQAGGAPLAYLVMELVNGEPL
FT                   NAVLSRLGHLSEAQALDLLEQTGRALQVAHSAGLVHRDVKPGNIMITPTGQVKITDFGI
FT                   AKAVDAAPVTKTGMVMGTAQYISPEQASGEDATAASDVYSLGVVGYECLAGKRPFSGDG
FT                   AITVAMKHIRDQPDPLPPDLPAPVRELITLTLVKDPRQRYANGGEFADAVATVKAGQRP
FT                   PMPRGWTGGATAASREAATAATTVVPPQPRPGPQPVTGNRNSSPTPRAAAAATPTQYDS
FT                   DGWTRSQKTILGVSVLLLLAAAAIIGGYLLISGGGDDPAPTTPTEPTLTAPPPTGAATS
FT                   ARQTTQAPPPPTRTVTETSTASPPPPPPTTTPPPTTTSDPPITGGEPTTTPTCTGILGI
FT                   PLPCRN"
     atgagtctgc agacgggctc cataatcgcc gaccggtatg aactgctccg gctcatcgcc        60
     accggcggta tgggtcaggt gtgggaggcg atggacacgc ggctggaccg ccgcgtggcg       120
     atcaaggtgc tcaaggccga gttctccgag gaccaggagt tcctggcccg gttccgcaac       180
     gaggcgcgca ccacggccgc attgaaccac cccggtatcg ccggggtcta cgactacggc       240
     gagacgcagg accaggccgg tggcgccccg ctggcgtacc tggtgatgga gctggtcaac       300
     ggcgagccgc tcaacgccgt gctctcgcgc ctgggtcacc tcagcgaggc gcaggccctg       360
     gacctgttgg agcagaccgg tcgcgcgttg caggtcgcgc acagcgccgg tctggtgcac       420
     cgcgacgtca agccgggcaa catcatgatc acgccgaccg gccaggtgaa gatcaccgac       480
     ttcggtatcg ccaaggcggt cgacgcggca ccggtcacca agaccggcat ggtgatgggc       540
     accgcccagt acatttcgcc ggagcaggcc tcgggcgagg acgccaccgc tgcgtcggac       600
     gtgtactcgc tgggtgtggt gggctacgaa tgcctcgccg gaaagcgccc cttctcgggc       660
     gacggtgcca tcacggtcgc gatgaagcac atccgggacc agcccgaccc gctgccgccg       720
     gacctgcccg caccggtgcg ggagctgatc acgctgacgc tggtcaagga tcctcggcag       780
     cgctacgcga acggcggcga gttcgccgac gccgtcgcca cggtgaaggc gggccagcgt       840
     ccgcccatgc cgcgcggctg gaccggcggc gcgaccgcgg cctcgcggga ggcggcgacc       900
     gccgccacca cggtggttcc cccgcagccg cgcccgggtc cgcagccggt caccggtaac       960
     cggaactcgt cgccgactcc gcgggccgca gccgccgcga cgcccacgca gtacgacagc      1020
     gacggctgga ccaggagcca gaagacgatc ctcggtgtct cggtgctgct gctgctcgcc      1080
     gcggccgcga tcatcggtgg ctacctgctg atcagcggcg ggggcgacga tccggccccg      1140
     accacgccga cggagcccac cctgacggcg ccgccgccca cgggtgcggc cacctcggcg      1200
     cggcagacca cacaggctcc cccgccgccg acccgaacgg tgacggagac gtcgacggca      1260
     tccccgccgc ccccgccgcc caccaccact ccgccgccga cgacgacctc ggatccgccg      1320
     atcaccggcg gtgagccgac gaccacgccg acgtgcaccg gcatcctcgg aatccccctc      1380
     ccctgcagga actaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page