(data stored in ACNUC1104 zone)

EMBL: CP001966.PE280

CP001966.PE280       Location/Qualifiers
FT   CDS_pept        complement(294716..295498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1243c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76934"
FT                   /db_xref="GOA:D5UQV1"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV1"
FT                   /inference="similar to AA sequence:KEGG:MAB_1243c"
FT                   /protein_id="ADG76934.1"
FT                   /translation="MTTEPVALTTDGSEREAPDRTARNDKGSTVIDDRVRRRLVEHAVR
FT                   SASGTAEERGLTSLIGLGLPSVEFSNNDRSVDVKIAAIWPFNSAHLVSEVQSSINNELA
FT                   RSLAERPNTARVHIARVIERRPGSKAPAASGSALKEGEPSDPSVRTVPRKTAGSVFVAI
FT                   PVLLVLMAVGIVAIRDTVIWFGWAHGSRWIDAVLRIADDLKWEWWTWPAAIAAVALGGI
FT                   FVTAALKPRRRSHTAVTDHLWFGRTLHSRRREEFEVPS"
     atgaccaccg aaccggtagc gctaacaaca gacggcagcg aacgggaggc tcctgatcgc        60
     actgcgcgta acgataaggg cagcaccgtc attgacgatc gtgttcgtcg ccggctcgtc       120
     gaacacgcag tgcgctcagc ttcaggcacc gcggaggagc gggggttgac gagcctcatc       180
     ggattaggcc tgccctcagt ggagttttcc aataacgatc gcagcgttga cgtcaagatc       240
     gcagccatct ggccatttaa ttccgcacac ctggtcagcg aagtgcagtc atcgatcaat       300
     aatgagctcg cacgcagtct cgctgaacgg ccaaacaccg cacgcgttca catcgcccgg       360
     gtcatcgaac gccgaccggg atcaaaggca ccggcagcgt cgggctcggc gctaaaggaa       420
     ggcgaaccct ctgatcccag cgtgcgcacc gtgccacgaa aaacagccgg gtctgtgttc       480
     gtcgcaatcc cagtgctcct tgtgctcatg gcagtaggga tcgtcgcgat ccgcgacacc       540
     gtcatctggt tcgggtgggc gcacggtagt cgatggatcg acgcggtctt gcgcatcgca       600
     gatgatctga aatgggaatg gtggacatgg ccagcagcga tagccgccgt cgcgctcggg       660
     ggcatcttcg tcaccgctgc gcttaaaccc cgccgacgca gccataccgc ggtcaccgat       720
     cacctctggt ttggccggac tctgcattcc aggcgtcgtg aagaattcga ggtgccatca       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page