(data stored in ACNUC1104 zone)

EMBL: CP001966.PE281

CP001966.PE281       Location/Qualifiers
FT   CDS_pept        complement(295501..295686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1244c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76935"
FT                   /db_xref="GOA:D5UQV2"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV2"
FT                   /inference="similar to AA sequence:KEGG:MAB_1244c"
FT                   /protein_id="ADG76935.1"
FT                   /translation="MTPGNFTVWGTVIGLLVAIAIVTGGIVGFLLAVVFGAAGLAIGAH
FT                   FDGLIDLTALRKSGRS"
     atgacaccag gcaacttcac cgtgtggggc actgtgatcg gcctacttgt agcgatcgcg        60
     atcgtcaccg ggggaatcgt aggctttctc ctcgctgtcg tttttggtgc ggccggtctt       120
     gctatcgggg ctcactttga cggcctgatc gacttgacag cgctccgaaa gagcggccgg       180
     agctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page