(data stored in ACNUC1104 zone)

EMBL: CP001966.PE284

CP001966.PE284       Location/Qualifiers
FT   CDS_pept        complement(296615..296935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76938"
FT                   /db_xref="GOA:D5UQV5"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76938.1"
FT                   /translation="MKRSLSGVVLIFLGIALLAFGVVALGFQNSVAGWAFVAVGVMTIM
FT                   LGAAALLSIRYGADRHVDKDRGELDPILGDGATSSAEERKFAERYRENSHEAGGRHRAR
FT                   GV"
     atgaagcgtt cgctatcggg cgtagtgctg atatttctgg gtatcgcctt gctggcgttc        60
     ggcgtagttg ctcttggatt tcagaacagc gtggcgggat gggcatttgt cgcggttggt       120
     gtgatgacaa tcatgctcgg cgccgccgcg cttttgagta tccgttacgg agcggaccgc       180
     catgtcgata aagatcgcgg cgaactggac cctattttgg gtgacggcgc aacttcctcg       240
     gcggaggaac gcaagttcgc cgaacgttac agggaaaatt cgcacgaggc aggtggaagg       300
     cacagggcgc ggggcgtcta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page