(data stored in ACNUC1104 zone)

EMBL: CP001966.PE285

CP001966.PE285       Location/Qualifiers
FT   CDS_pept        complement(298595..299371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76939"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76939.1"
FT                   /translation="MIDSMGHDRQDRFPDDHVPGGNAGRPWQPRGDLGDLDPDALFGAF
FT                   GQPLTDGPTIEWMPGMADQMLRELAPLLAEDGIDITADALDTDLATLQAALDRAVARHN
FT                   HTLATPTGEQRSWCTSTLRLLAESIDTDNLDLAEGILETVPPESPDGKATVAGVIGVGA
FT                   QLLDSWLTTPPAGINKTAAATIVIRPPRWHGERAAIDLLALARKNKAHLSHGKIIAAHG
FT                   GHTTLYGTALAVTAVLAAWADHTKTTVTNLAGTHLR"
     atgatcgaca gtatgggcca cgaccggcaa gaccgcttcc ccgacgacca cgttcctggc        60
     gggaacgccg gccgcccctg gcagccgcgc ggcgatctcg gggacctcga cccggatgca       120
     ttgttcggtg cgttcggcca gcccctcacc gatggcccca ccatcgagtg gatgcccggc       180
     atggccgatc agatgctgcg tgagttggca ccgctgctcg ccgaggacgg catcgacatc       240
     accgccgatg ccctcgacac cgacctggcg accctgcaag cggccctcga ccgcgccgtc       300
     gcacgtcaca accacacgct cgccaccccg accggtgagc aacgcagctg gtgcacctcc       360
     accctccggc tgctcgccga atccatcgat accgacaatc tcgacctcgc tgaagggatc       420
     ctcgaaaccg tccccccgga atcacccgac ggcaaagcca cagtcgccgg cgtcatcggc       480
     gtcggcgccc agctcctcga ttcctggctc accacaccac cggcaggcat caacaaaacc       540
     gcggcagcaa ctatcgtcat ccgaccccca cgatggcacg gagaacgcgc cgccatcgac       600
     ctcctcgccc tggcccgcaa gaacaaagcc cacctcagcc acggcaaaat catcgcggcc       660
     cacggcggcc acaccaccct ctacggcacc gctctcgccg tcacggccgt cctggcagcc       720
     tgggccgacc acaccaagac caccgtcacc aacctcgccg gcacgcacct tcgctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page