(data stored in ACNUC1104 zone)

EMBL: CP001966.PE288

CP001966.PE288       Location/Qualifiers
FT   CDS_pept        301832..302647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0296"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rop:ROP_07010
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76942"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV9"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG76942.1"
FT                   /translation="MIRRIARALLGSYFIYSGANTLLRPGETAHAAAGVVHKAQETFPE
FT                   APLPASPAAWARALGGVQLSAGTLLALDRLPRLSALTLAGSLAAATATENRFWSESDPG
FT                   IREEATVHFLKNISLIGGLVIVGLDTEGEPGVVWRTKRAGRRAADRAAAAVAVLNPAAD
FT                   NGSDTKNLAAELQEKAHDTAEKLGDRLADTREVIERNIAHAGEMAAPVASTLAQAAGTQ
FT                   AARLSTAASETLTDLREHAPAYAEQVRDNAQRLVATAQDHTPAVRQPQA"
     atgattcgtc gcatcgcccg cgctttgctc gggtcttact tcatttactc aggcgcgaac        60
     accctgctcc gccccggtga gaccgcacat gctgcggccg gcgttgtgca caaggcgcag       120
     gagacttttc ccgaggcgcc gctcccggct agccccgccg cctgggcgcg ggcactcggc       180
     ggtgttcaac tcagtgccgg caccctgctc gcactcgacc ggttgccccg actgagcgcc       240
     ctaacactgg caggcagcct cgccgcagcc accgcgacgg agaaccggtt ctggtccgaa       300
     tccgatccgg gtattcggga agaagccaca gtccatttcc tcaagaacat ctcactgatc       360
     ggcgggctag tcatcgtcgg ccttgacacc gagggagaac ctggcgtcgt gtggcgcact       420
     aaacgagccg gtaggcgagc ggccgatcgc gccgccgccg ccgtcgcagt cctcaaccct       480
     gccgcggaca acggttcaga caccaagaat cttgctgcag agcttcagga gaaggcgcat       540
     gacaccgccg agaagctcgg agaccgcctc gcagacacgc gcgaggtgat cgagcggaac       600
     atcgctcacg ccggtgaaat ggcggcaccg gtggcatcaa cgctcgcaca agcggcgggc       660
     acacaagccg ctcgcctctc caccgcagcg tccgaaacac tgaccgacct acgcgagcac       720
     gcacccgcct acgccgaaca agtgcgagac aacgcccaac gcctcgtagc taccgcccag       780
     gaccacaccc ccgcggtacg ccaaccacag gcatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page