(data stored in ACNUC1104 zone)

EMBL: CP001966.PE289

CP001966.PE289       Location/Qualifiers
FT   CDS_pept        complement(302887..304365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0297"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   nfa:nfa30230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76943"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW0"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG76943.1"
FT                   /translation="MISGFAEHWQCPTGEWVVWAPDANTCEAMRNAPDLGVETSFIQAD
FT                   HLRSGIEGESCVRRLVFTSFTVHDKFDAETIAKVFTDFVRAHETFHTAFPVSTDLRPRG
FT                   RTLRPEQISLAVTARSQDHPERTVKDHLIESVPTLHEWAAFAFAVNGIENAGPDAVDPH
FT                   FQVVVGSDHMFTDGVSQAISFFEILSRYTAARTGTPYEPVPVRPYPQFCAEQRALAATL
FT                   TPTHPDVEQWRDTLARAGGMPKFPLPLGLGPGEAAPGKIAVHASFVDAAQAARFGAAAK
FT                   QAGGNTSSALLAVLGQVHHALTGERLFTMLIPRADRSATGDAMAVGWYVTLVPVQFDAS
FT                   GTFAEATRNAQEALGVARQLDRTPVFPVIDMLANDPGFPVQHGFTSPMLSYIDVTRVPG
FT                   AELARQHDFSVFANATPSREVFMWINRDESGLDFNAQHPETVEATRAVDTVFRLLRDRI
FT                   IEVGKALGLRETGLSTVSVDSSGSSANGIAPGQL"
     atgatttcgg gattcgcgga acactggcag tgccccaccg gcgagtgggt cgtctgggcc        60
     cctgatgcga acacgtgcga ggccatgcgc aacgctcccg acctgggcgt tgagacctcc       120
     ttcatccagg ccgatcacct tcgcagtggc atcgagggtg agtcctgcgt acgacgcctg       180
     gtattcactt cttttaccgt gcacgataaa ttcgatgcag aaacaattgc gaaggtcttc       240
     actgatttcg tgcgcgcaca tgaaactttt catacggcgt tcccggtgtc gaccgatctt       300
     cgaccacgcg gccggacgct gcggcccgag caaatctcgc tcgccgtcac agcgcgttcg       360
     caggatcatc cggagcgcac cgtcaaggac catctgatcg agtcggtgcc cacgctgcac       420
     gagtgggcag ccttcgcgtt cgccgtgaac ggcatcgaga acgcgggccc ggatgcggtc       480
     gatccgcact tccaggtggt ggtcggctcc gaccacatgt tcaccgacgg ggtatcgcag       540
     gcgatcagct tcttcgagat cctctcccgc tacacggcgg cccgcaccgg cacgccgtac       600
     gagccggtgc ccgtgcgccc gtatccgcag ttctgcgccg agcagcgggc cctcgcggcg       660
     acgctcaccc ccacccaccc cgacgtggag cagtggcgcg acacgctcgc ccgcgctggc       720
     ggtatgccca agttcccgct cccgctgggc ctggggcccg gtgaagccgc tcccggcaag       780
     atcgcggtgc acgcttcgtt cgtggatgcc gcccaggcag cccgcttcgg tgccgccgca       840
     aaacaggcgg gcggcaacac gagcagcgcg ctactagccg tcttgggcca ggtgcatcac       900
     gccctgaccg gggagcgcct gttcaccatg ctgatcccgc gggcggaccg ctccgcgacc       960
     ggtgatgcaa tggcggtcgg ctggtacgtg acgctggtgc cggtgcagtt cgacgccagc      1020
     ggcaccttcg ccgaggcgac gcgcaacgcc caggaggcgc tcggcgtggc ccggcagctc      1080
     gaccgcacac cggtgttccc cgtgatcgac atgctggcca acgatcccgg tttcccggtg      1140
     cagcacggct tcacctcgcc gatgctctcc tacatcgacg tcacccgggt gccgggcgcc      1200
     gaactggccc ggcagcacga cttctcggtg ttcgccaatg ccactccctc gcgggaggtg      1260
     ttcatgtgga tcaaccgcga cgagtcgggt ctcgacttca acgcacagca tccggagacg      1320
     gtggaggcga cccgcgccgt ggacaccgtg ttccgactcc tgcgcgatcg gatcatcgaa      1380
     gtcggaaaag ccttgggctt gagagaaacc ggtctgtcca ccgtgagcgt cgacagctcg      1440
     ggttcctctg caaacggcat tgccccggga caattgtga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page