(data stored in ACNUC1104 zone)

EMBL: CP001966.PE29

CP001966.PE29        Location/Qualifiers
FT   CDS_pept        complement(29957..31471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0029"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: rha:RHA1_ro03698 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76683"
FT                   /db_xref="GOA:D5UPD1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADG76683.1"
FT                   /translation="MNTPIRRVSVVVVLLVVALLANATYVQVFKADELRSDPRNERVLL
FT                   DEYSRQRGSILAGGQVMAQSVPTDDRYKYLRTYPKDLAPAYAPVTGYYSMVYSAGALEH
FT                   AEGSILNGSDDRLFGRRIVDTLSGRDPRGGNVVTTINPVMQRIAYERLISACGAKGPCH
FT                   GSVVAMEPQTGKILAMVSTPSYDPNPLSSHDPSVVSAAWQNLTKDPDQPMLNRATSQLY
FT                   PPGSTFKVITTAAALSQGRGIDLNTRLTADKQITLPGGGGTTLQNYAGMTCPDSSGGTV
FT                   SLLQAFQYSCNTAFVDLSTQKMQDGGEAIKQMANNFGVNSSPEPIPLPVSQSVTGPLSY
FT                   PAQVGQSAIGQLDVALTPLQNAVIAATLANGGIRMQPYLVDSLQSPDLSTIATTSPKRQ
FT                   GQALSPEVAAQMRELMVASERNTKGSGGSVSIASKTGTAEHSEGQKGGEAPHAWYIGYG
FT                   PVNDPKVAVSVIIENGGNQGEQATGGSLAAPIGRAVIGAAVNGQGN"
     atgaatacac cgatccgccg cgtctccgtc gtcgtggtcc tgctcgtggt cgcgctcctc        60
     gcgaacgcca cctatgtgca ggtcttcaag gccgacgagc tccgttccga cccgcgcaac       120
     gagcgggtcc tgctcgacga gtactcgcgc cagcggggct cgatcctcgc gggcggccag       180
     gtgatggccc agtcggtgcc caccgacgac cggtacaagt acctgcgcac ctacccgaag       240
     gacctcgcgc cggcgtacgc ccccgtcacc ggctattact ccatggtcta cagcgccggt       300
     gcgctagagc acgccgaggg atcgatcctc aacggcagcg acgaccgcct gttcggccgg       360
     cgcatcgtcg acaccctgtc cggtcgcgat ccgcgcggcg gcaacgtggt caccacgatc       420
     aacccggtga tgcagcgcat cgcctacgag cgcttgatct cggcgtgcgg cgccaagggg       480
     ccctgccacg gctccgtggt ggcgatggaa ccgcagaccg ggaagatcct cgcgatggtc       540
     tcgaccccga gctacgaccc caacccgctg tcctcccacg atccgagcgt ggtcagcgcg       600
     gcctggcaga acctcaccaa ggatcccgat cagcccatgt tgaaccgggc cacatcgcag       660
     ctgtacccgc ccggctcgac cttcaaggtg atcaccaccg cggcggcgtt gagccagggc       720
     cgcgggatcg atctgaacac ccgcctgacc gccgacaagc agatcaccct cccgggcggc       780
     ggtggcacca ctctgcagaa ctacgcaggg atgacgtgcc cggattcgtc gggcggtacc       840
     gtcagcctgt tgcaggcgtt ccagtactcg tgcaacaccg cgttcgtgga cctgtccacc       900
     cagaagatgc aggacggagg agaggcgatc aagcagatgg cgaacaactt cggcgtgaac       960
     agctcgcccg aacccatccc gctgcccgtg tcgcagtcgg tgaccggccc gctgtcctac      1020
     cccgcgcagg tggggcagtc ggcgatcggt cagctcgacg tggcgctgac cccgctgcag      1080
     aacgcggtga tcgcggcgac cctggccaac ggcggtatcc ggatgcagcc gtacctggtg      1140
     gacagcctgc agtcgcccga cctctccacg atcgcgacca cctccccgaa gcggcaggga      1200
     caggcgctga gcccggaggt cgcggcgcag atgcgggagc tgatggtcgc ctcggagcgc      1260
     aacaccaagg gctcgggagg cagcgtctcg atcgcgtcga agacgggcac cgcggagcac      1320
     tccgagggcc agaagggcgg cgaggcgccg cacgcctggt acatcgggta cggcccggtc      1380
     aacgacccga aggtcgcggt gtcggtcatc attgagaacg gtggaaatca gggcgagcag      1440
     gcgaccggtg ggtcgctcgc ggcgcccatt ggacgtgcgg tgataggcgc cgcggtgaac      1500
     gggcagggga actga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page