(data stored in ACNUC1104 zone)

EMBL: CP001966.PE290

CP001966.PE290       Location/Qualifiers
FT   CDS_pept        304595..304720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76944"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76944.1"
FT                   /translation="MLVHHVMLSAATATPVVTAKSQHAHNNRDGTHTFKHASMLR"
     gtgttggtgc accatgtgat gctgtcggcc gccaccgcta ctcccgtcgt caccgcgaag        60
     agccagcacg cacacaacaa cagagacggc acccacacct tcaagcatgc ttcgatgctt       120
     aggtaa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page