(data stored in ACNUC1104 zone)

EMBL: CP001966.PE291

CP001966.PE291       Location/Qualifiers
FT   CDS_pept        complement(304793..305662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_02300 porin MspA"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76945"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76945.1"
FT                   /translation="MTKKSNYRPIMVAHPLGRRSLSAAIATGILLVATPLQVQASPVSP
FT                   SNERAGAVQERMVTKTTPTGVVMKVGLRSPRVESYPPLDSSPFSREAFLSMRGSAILTG
FT                   QKDAIKSSRTKLDMGYQIGYPMSVAKDGAKIGIVTPNLTVNAGVKPEAGVGANAGVTPK
FT                   FGVNGSATGGGGTSGGNGSGTVGGNVGADVPLGVNASSKVGAELGVKSDIIPSQKIDFT
FT                   IGHGEIKEISVAKFELKQDDAILDVDGTEISVTAMAGRVSIRPYVRASIETAKGISTTV
FT                   VYGAVAYL"
     gtgaccaaga agagcaacta tcgaccgatc atggtcgcgc atcccctcgg ccggcggagt        60
     ctatctgctg caatagcgac tggaattctg ctggtcgcaa ctcctctgca ggtgcaagcg       120
     tcccctgttt ccccctcgaa cgaacgcgct ggtgcagtgc aggaaagaat ggtcaccaag       180
     accacaccaa ctggagtcgt gatgaaggtg ggcctgcgat ccccgcgtgt agaaagttac       240
     cctcctctcg actcttctcc ctttagtcgg gaagcgtttc tatccatgcg tggaagcgcg       300
     atattgacag ggcagaagga tgcaattaaa agctcgagaa cgaaactgga catgggatac       360
     cagattggat acccaatgtc cgttgcgaaa gatggcgcca agataggaat tgttacacca       420
     aacctgaccg tgaatgccgg agtaaaacca gaagcgggtg tgggagccaa cgctggagta       480
     acaccaaaat tcggtgtgaa tggatcagca acaggtggcg ggggaacctc gggtggtaat       540
     ggtagcggaa ctgtcggagg taatgtggga gcggatgtcc ctctcggggt aaacgcgtcc       600
     tcgaaggttg gtgccgaact cggggtgaaa agcgacatca ttcctagcca gaagatcgac       660
     ttcacgattg gtcacggcga aataaaagaa atttcggtag cgaaatttga attaaagcaa       720
     gacgacgcaa tcctcgatgt tgatggcact gaaatcagtg tcacagcgat ggcggggcgg       780
     gtcagtatac gcccatacgt gcgcgcgagt attgaaaccg ccaaaggtat ttccacaact       840
     gttgtctacg gcgcagtagc ttacttgtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page