(data stored in ACNUC1104 zone)

EMBL: CP001966.PE295

CP001966.PE295       Location/Qualifiers
FT   CDS_pept        complement(309516..309845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0303"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nca:Noca_2153 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76949"
FT                   /db_xref="GOA:D5UQT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76949.1"
FT                   /translation="MARKSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVD
FT                   KLGSGTRTASAAAGVSVGRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFA
FT                   GETSW"
     atggccagga agagttacac cgatgagttc cggtgccggg cggtggactt gtatgagtcg        60
     acgccgggtg cgacgttgca ggggatcgcg gcggatttgg gtgtgtcccg gggatcgttg       120
     aaggggtggg tcgacaagct cggctccggg acgaggaccg cgtcggctgc ggcgggggtg       180
     tcagtggggc ggcgggagtc gcaggcggcg aggatcacga ggctggaggc cgagaatggg       240
     gtgttgcggg tcgagcaggc aaagcttgct gaggaacgcg acattctccg tcaggcggcg       300
     aagtatttcg ccggggagac gagttggtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page