(data stored in ACNUC1104 zone)

EMBL: CP001966.PE296

CP001966.PE296       Location/Qualifiers
FT   CDS_pept        309871..311073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76950"
FT                   /db_xref="GOA:D5UQW7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76950.1"
FT                   /translation="MCWITRVQEQGVRPSLCNDARTSPVQMPRSSNSEVNRIAGFVWRM
FT                   PGIFDRDRDLTSSSGRRAVFPGVVPIIVAAVVVGVALILGAVSVSHRAPNGNRDDVVAA
FT                   EQKVHETQMRLDAALLGGLSEVQSVAAPAVGKAVDWQRDVTTVLGRRSELRSVYAVANR
FT                   DGSVLARAGNTPSRIAGGTRIEPPAGGFGLLQASTSGAEPIILAIALSHDQSVTVVAEF
FT                   EPRKLNSLLMRFAGDSVVLGRTGKVILSSKGYRAFSMPGAETARLGGEATSVPFATILG
FT                   SGDDAAVLASERVGGQGPVSDLLWVVVQRTPVKPAIFSLPVSKRAALVAFGLIGLSTGA
FT                   LLLWLYASTTVPLRKVIAWLELVVHDHGAATPPLAPAPRRFDEVGALTSGLLYLVKRGP
FT                   R"
     atgtgctgga ttacacgtgt ccaagaacag ggggtaaggc cctccctctg caacgacgcc        60
     cgtacctcac cagttcagat gccacgttcg tcgaattcgg aagtgaatcg catcgccggc       120
     ttcgtctggc gcatgccggg gatcttcgac agggaccgag atctcacctc tagctctggc       180
     cgacgtgctg ttttccctgg agtcgtacca attatcgtcg ccgccgtagt ggttggggta       240
     gccctcatac taggggctgt ttctgtgtcg catcgcgctc ccaatgggaa tcgtgacgat       300
     gtggtcgcag ccgagcagaa ggtgcacgaa acgcagatgc ggctggatgc agcattgctt       360
     ggtggtctca gtgaggttca gtctgtggcg gcccccgctg tagggaaggc ggtcgactgg       420
     cagcgcgatg ttacgacagt gctcggtcgc aggtctgagt tgcgttcggt atacgcagtt       480
     gcaaatcgtg atggctctgt tctcgcgcgg gctgggaaca cgccttcgcg tatagccggg       540
     ggtactcgaa tcgaaccccc agcgggcggt ttcgggctcc tgcaagccag tacgtcgggc       600
     gccgagccaa ttatcttagc tatcgcactc agtcatgatc aatctgtcac ggtggtcgct       660
     gaatttgagc cacgtaagct caattccctg ctaatgcgct tcgcgggcga ttccgtcgtc       720
     ctcgggcgaa caggcaaagt gattctgagt tcgaaggggt atcgcgcatt ttcgatgcca       780
     ggcgccgaaa ccgctcgcct cgggggcgaa gctacttccg tgcctttcgc tactatactt       840
     gggtctggag acgatgccgc ggttctggca agtgaacggg tcggcgggca aggccctgta       900
     tcggacctgc tctgggttgt tgtacagcgc actcctgtca aacctgccat cttctcgcta       960
     cctgtttcta agcgcgcagc attagttgct ttcgggctaa tcggactgtc gacgggcgcc      1020
     ctgctgttgt ggctttatgc ctcgacgaca gtaccgctac gcaaagtgat cgcctggctg      1080
     gagctagtcg ttcacgacca cggcgcggcc acacccccgt tggctcccgc tcctcggcgc      1140
     tttgacgagg tcggtgcgct gacatccggt cttctatatc ttgtgaagcg gggcccgcgg      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page