(data stored in ACNUC1104 zone)

EMBL: CP001966.PE297

CP001966.PE297       Location/Qualifiers
FT   CDS_pept        311070..312260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0305"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; KEGG:
FT                   dsy:DSY4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76951"
FT                   /db_xref="GOA:D5UQW8"
FT                   /db_xref="InterPro:IPR008337"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW8"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADG76951.1"
FT                   /translation="MIVLYALVVSACLALLGCGVLEQYRHHRNLHSIPIRVVVNGIRGK
FT                   SSITRLCAGALRGGGLVTVAKTTGTAARFIPPDGVDEQIHRRFGLANVIEQVGIVRRAA
FT                   SFRPDALVIECMAVLPDLQEINERKLIHSTICVICNVREDHVDEMGPTLEDIARSLSRS
FT                   MPEGGVCITAEKEYVHILREEARKRGCRLVEVESDDIGDEILAEFPFITFKENIAIALA
FT                   VAELCGVDYRAALRGMIESPADPGTVAVKEYRYRGTVITVANLFAANDPESTRMNVELL
FT                   TARGLIGRPLNVIVNCRPDRVERNGQMGALTSALDPERIILIGEPTRSARVTVPDQLAV
FT                   RIADLGGRLDFDRVLAAIASDDDGEASVVTIGNIHGNGEILLHAFETLDHNPLEAP"
     gtgattgttc tctacgcact tgtcgtgagc gcctgccttg ctttgctcgg atgtggagta        60
     ctggaacagt atcgacatca ccggaaccta cattccattc ctattcgagt agtagtgaac       120
     ggcatccgcg ggaagagctc gattacccgg ctgtgtgccg gcgcgctgcg cggtggtggc       180
     ctggtcaccg ttgcgaagac taccggaacc gcggcccgct tcatcccgcc cgacggtgtc       240
     gatgaacaga tccatcgtcg cttcggcttg gcgaatgtga tcgagcaagt gggcatcgtc       300
     cgacgagccg cctcgttccg cccggacgcg ctcgtcatcg agtgcatggc cgtgcttcca       360
     gatctccagg aaatcaacga gcgcaagctg atccactcga ctatctgtgt gatctgcaac       420
     gtccgagaag accacgtcga tgagatgggg ccaaccttgg aagacatcgc ccgatcgcta       480
     tctcgctcga tgccggaggg aggagtgtgt attaccgccg agaaagaata cgtgcacatc       540
     ttgcgcgagg aagcgcgaaa gcgcggttgt cggctcgtcg aggtcgagtc cgacgacatt       600
     ggggacgaga tcttggccga atttcccttc atcacgttca aggagaatat cgccattgcc       660
     ttagcggtcg ctgagctgtg cggagtcgat taccgggcgg cactgcgcgg catgatcgag       720
     tcgcccgcgg atcctggaac cgttgcagta aaggaatatc gctatcgggg gacagtcatc       780
     accgtggcga acctgtttgc ggcgaacgat cccgagtcga ctcgaatgaa cgtcgaactg       840
     ctcacagcgc gcgggctaat cgggcgtccg ctgaatgtga ttgttaattg tcggccggat       900
     cgtgttgagc gcaacggcca gatgggcgct ctcaccagcg cactcgatcc cgaacggatc       960
     atcttgatag gagagccgac gcgttcagct cgggtaaccg ttccagatca gctcgccgtc      1020
     cgaatcgccg atctcggtgg acgtctggac ttcgaccggg tactcgccgc aattgcatct      1080
     gatgacgatg gtgaagcttc ggtcgtgact attggcaata ttcacggtaa cggcgagata      1140
     ttgctccatg ctttcgaaac actcgatcac aacccgctgg aggctccata a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page