(data stored in ACNUC1104 zone)

EMBL: CP001966.PE299

CP001966.PE299       Location/Qualifiers
FT   CDS_pept        312736..313752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4672 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76953"
FT                   /db_xref="GOA:D5URA0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76953.1"
FT                   /translation="MIRLDLRELSARGRRLAVLCFVFVIIGGTGIGIGTARVYSRANST
FT                   EAVELLPAFSTLHFERLADPARTLARDDRGRVVAIMTDGARTVVLAGRLRTFVEPETTA
FT                   AIVASNARVLLLPRSWSAGGEGDTWFSTWYLAARETSVDLLEAATQYLTGADSDFDARG
FT                   IEYRGDAHYPGVSATGERVPGDFNDYLGVAWTFSDGATRQAPPTRSRALSSAGLVRLVF
FT                   GYRGGMPLSGHVRDPSGMAPTVDELFYGAGATIAPVTGAAVSDLGRLQPGDLLFFDTDP
FT                   DATLDQVAIYLGVDQRSEHRFIMSRREADGPTMGDTGGRSVVDRGRFASALRAVKRI"
     atgattcgcc tggatttgcg tgagctgtcg gcgcgtggca gacgcctcgc tgttctgtgc        60
     ttcgtgttcg tgatcatcgg cggcaccgga atcggtatcg gaaccgcccg agtatatagc       120
     cgtgcgaaca gcacggaggc cgttgagcta ctgcccgcgt tcagcacgct gcatttcgag       180
     cgtctggccg accccgctcg caccctcgcc cgcgacgacc gggggagagt tgtagcgatc       240
     atgacggacg gcgcccgcac agtcgtcctc gcaggccgac tgcggacctt cgtggaaccc       300
     gagacgacgg cggcaatcgt cgcctcgaac gcacgggtgc tactgcttcc tcgctcctgg       360
     tccgcagggg gcgagggtga cacgtggttc agcacctggt atctcgctgc aagagagacc       420
     agcgtcgacc tgctcgaggc cgccacccag tacctgaccg gcgcagattc tgatttcgac       480
     gcacgtggca tcgaatatcg aggtgatgcc cactacccgg gcgtctcagc gacaggggag       540
     agggtgcccg gggacttcaa tgattacctg ggcgtggcgt ggaccttttc tgacggcgct       600
     acccgacagg ctcctccgac gagatcacgt gcgctgagca gtgccggttt ggtacggtta       660
     gtgttcggat atcgtggtgg gatgccgtta tcaggccacg taagagatcc atcagggatg       720
     gcgccgacgg tcgatgaact cttttacggt gcgggtgcca cgatcgcacc tgtgacgggt       780
     gccgccgtca gtgatctcgg tcggctccag ccgggcgatc tgcttttctt cgataccgat       840
     ccagacgcta ccttggacca agtggcgatc tacctgggag tagatcaacg cagcgagcac       900
     cgcttcatca tgagccgccg cgaagctgac ggaccgacga tgggcgatac gggtgggcgg       960
     tctgtggttg accgcgggag gttcgcctca gcgctgcgtg cagtgaaacg gatatga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page