(data stored in ACNUC1104 zone)

EMBL: CP001966.PE3

CP001966.PE3         Location/Qualifiers
FT   CDS_pept        2938..4128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: rha:RHA1_ro03667 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76657"
FT                   /db_xref="GOA:D5UPA5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG76657.1"
FT                   /translation="MSLPKGSVGMKFRVPHEEFAESVAWVARSLPSRPPVPVLGGVLLT
FT                   AGDDGLTVSGFDYEVSAQVRVGAEVADEGQVLVSGRLLADITKALPNKPVDVELDVTRV
FT                   AISCGSAKFSLPTMPVEDYPQLPELPQQTGAIERSMFAEAISQVAIAAGKDDTLPMLTG
FT                   IRVEIEGQRVVLAATDRFRLAVREFDWQPQSGDVKAAVLVPAKTLSEAAKTFAGDSEVG
FT                   IALGAGSAVGADGLLGVVGPDRRTTTRLLDADFPKFRQLLPASHTAIATMEIAPLLEAI
FT                   KRVALVADRGAQVRMEFGDGTLRLSAGGDDAGKAEEELPADFQGEPLTIAFNPGYLQDG
FT                   LAAIHTDSVTFGFTTPSRPAVLRPTVENAFQPDDSGAFPAPQSAYTYLLMPVRLPG"
     atgtccctac cgaaaggctc cgtcggcatg aagtttcgcg tcccgcacga ggagttcgcc        60
     gaatccgtcg cgtgggtagc ccgcagtctg ccgtcgcgtc ctccggtacc ggtcctcggc       120
     ggtgtcctgc tgaccgcggg tgacgacggg ctcaccgtct ccggattcga ctacgaggtt       180
     tcggcacagg ttcgggtcgg cgccgaggtc gccgacgagg gccaggtcct ggtgtccggg       240
     cgcctgctcg ccgacatcac caaggcgttg cccaacaagc cggtcgatgt ggagctggac       300
     gtgacccggg tcgcgatcag ttgtggcagt gcgaagttct cgctgcccac gatgccggtc       360
     gaggattacc cgcagctgcc cgagctgccg cagcagaccg gtgcgatcga gcgcagcatg       420
     ttcgccgagg cgatctccca ggtggccatc gcggccggta aggacgacac cctgccgatg       480
     ctcaccggta tccgggtcga gatcgaaggt cagcgtgtcg ttctcgcggc caccgaccgg       540
     ttccgcctgg ccgtgcgcga attcgactgg cagccgcagt ccggcgacgt caaggccgcc       600
     gtcctggtgc ccgcgaagac gctgtccgag gccgcgaaga ccttcgccgg tgattccgag       660
     gtaggaatcg ccctgggcgc gggttccgcg gtgggtgccg atggcctgct cggtgtggtc       720
     gggccggatc gccgcaccac cacccgcctc ctcgacgccg acttcccgaa attccgccag       780
     ctgttgcccg cttcgcacac cgcgatcgcc acgatggaga tcgcgccgct gctcgaggcg       840
     atcaagcgcg tggccctggt ggccgaccgc ggcgcccagg tgcgcatgga gttcggtgac       900
     ggcacgttgc ggctctcggc cggcggagac gacgcgggga aggctgagga ggagctcccc       960
     gccgatttcc agggcgagcc gctcaccatc gccttcaacc cgggctacct gcaggacggc      1020
     ctcgctgcca tccacacgga ttcggtgacg ttcggtttca ccacaccgtc tcggcctgcg      1080
     gtgctgcggc ccacggtgga gaatgctttc cagccggacg actcgggggc cttccccgcg      1140
     ccgcagagcg cgtacacgta cctgctgatg cccgtgcgtc tgcccggctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page