(data stored in ACNUC1104 zone)

EMBL: CP001966.PE30

CP001966.PE30        Location/Qualifiers
FT   CDS_pept        complement(31468..32895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0030"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: nfa:nfa830 putative
FT                   cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76684"
FT                   /db_xref="GOA:D5UPD2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADG76684.1"
FT                   /translation="MTSATATNTPGSGLALDPNRGSRSRELVLLGAATVITGASLAIVE
FT                   WAQKQTISWDLAKYVVAFVVLYAAAHVAVRRFAPYADPLILPVVALLNGLGLVLIHRLD
FT                   LGRAHGENGRIQEINEANQQILWTLMGVAVLVAILALLRDHRTLAKYAYTIGLVGLILL
FT                   ALPALLPASLSEINGSKNWIKTPLFSIQPSEISKILLIIFTAAFLVSKRDLFTTAGRRV
FT                   LGIDLPRPRDLAPLLLVWIVALAVLGYANDLGTPLLIFFTVLAMVYIATERVGWVVVGL
FT                   ALAVVGAVAAYFLFSHLRVRVEVWLHPFDHYEDIGFQPAQSLFSLATGGLAGTGLGSGR
FT                   PTMVPFASTDFIISAIGEELGLIGLAAVLMLFLILIFRAFRISLTVRDSFGKLLAAGLA
FT                   STVAIQLFVVVGGVTKLIPLTGLTTPFVSYGGSSLLTNYALIALLLRISNAAREPKVTR
FT                   KPGAPVPDRPTEIVKRV"
     gtgacgtccg caaccgctac caacaccccc ggaagcggcc tcgcgctcga cccgaaccgc        60
     ggatcccgct cacgggaact cgtgctgctc ggtgccgcga cggtgatcac cggcgcgtcg       120
     ctcgcgatcg tcgagtgggc ccagaagcag accatcagct gggatctcgc caagtacgtc       180
     gtcgcgttcg tcgtgctgta cgccgcggcg cacgtggcgg tgcgccggtt cgcgccctac       240
     gccgacccgc tgatcctgcc cgtggtggcc ctgctcaacg ggctcggact ggtactgatc       300
     caccggctcg acctgggtcg cgcgcacggc gagaacggcc ggatccagga gatcaacgaa       360
     gccaatcagc agatcctgtg gacgctgatg ggtgtggccg tgctggtcgc gatcctcgcg       420
     ctgctgcgcg atcaccgcac actggccaaa tacgcgtaca cgatcggcct cgtcggcctg       480
     atcctcctgg cgttgcccgc gctgctgccc gccagcctgt cggagatcaa cggctccaag       540
     aactggatca agacgccgct gttcagcatc cagccgagcg agatcagcaa gatcctgctg       600
     atcatcttca ccgcggcctt cctggtgtcc aagcgcgacc tgttcaccac cgccggacgg       660
     cgcgtgctcg gcatcgatct accccgcccc cgcgacctgg caccgctcct gctggtgtgg       720
     atcgtggccc tcgcggtgct gggttacgcc aacgacctcg gcaccccgct gctgatcttc       780
     ttcaccgtgc tcgcgatggt gtacatcgcc accgagcgcg tcggctgggt ggtcgtgggc       840
     ctggcactgg ccgtggtcgg cgccgtagcc gcgtatttcc tgttcagcca cctgcgggtg       900
     cgcgtggaag tgtggctgca ccccttcgac cactacgagg acatcggttt ccagcccgcg       960
     cagtcactgt tctccttggc cacgggcggt ctcgccggca ccggcctcgg ctccggccgg      1020
     cccaccatgg tgcccttcgc gtcgaccgac ttcatcatct cggcgatcgg tgaggagctg      1080
     ggcctcatcg gtctcgctgc ggtattgatg ctgttcctga tcctcatctt ccgcgccttc      1140
     cggatcagcc tgacggtgcg cgacagcttc ggcaagctgc tggccgccgg actcgcgtcc      1200
     actgtcgcga tccagctgtt cgtggtggtc ggcggcgtca ccaagctgat cccactgacc      1260
     ggtctgacca cgcccttcgt cagctacggc ggttcgtcgc tgctgaccaa ctacgcactc      1320
     atcgccctgt tgctgcggat ctcgaacgcg gctcgtgaac ccaaggtcac gcgcaagccc      1380
     ggtgcaccgg tccccgaccg gcccaccgag atcgtgaagc gcgtatga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page