(data stored in ACNUC1104 zone)

EMBL: CP001966.PE301

CP001966.PE301       Location/Qualifiers
FT   CDS_pept        complement(314913..315704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0309"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   cai:Caci_1970 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76955"
FT                   /db_xref="GOA:D5URA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA2"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADG76955.1"
FT                   /translation="MAHVTDSGNSGNGIDAHERRREMGRFLKARRARGSLPAGKAMTRQ
FT                   QVAELVHVSIDYYTRIEQGRATPSASVTNQIFEVFKFNADERKYIKDLVDPGATLPPSE
FT                   PSGFMHTFLAGVREVPAIIVGPHTSIHGWNAAANRIIVNFDEIPAAERTLARMIFGNAN
FT                   FRALFANIREYEILAAGVLRSTSAPSPACPKLVEEVEYLSSRYPTFKYLWARFTVSQPR
FT                   GRRELTLVDNKGNEKCFELASFQNIDDRWYRILMLIRPGAT"
     atggcacacg tcacagacag tggtaacagt ggtaacggca ttgacgcgca cgaacgtcgc        60
     cgggagatgg ggcggttctt aaaagctcgc agggctaggg gaagtctgcc tgccggaaaa       120
     gcgatgacac gacagcaggt cgcggagttg gtacatgtta gtattgacta ctacacccgc       180
     atcgaacaag ggcgcgccac tccgagcgct tctgtgacta atcagatctt cgaggtgttc       240
     aaattcaacg ccgacgagag aaagtatatc aaagacttag ttgatccagg agccacttta       300
     ccgccttcag agccgagcgg ctttatgcac acatttctcg ctggcgtaag agaggtgccg       360
     gctattattg tggggccgca caccagtatt catggatgga atgctgctgc taaccgtatc       420
     atcgtcaatt tcgatgagat tccagcagct gaacgaacgc tcgcgcgaat gattttcggc       480
     aacgccaact ttcgcgcttt gttcgccaat attcgcgagt atgaaatact tgcggctgga       540
     gtacttcgat ccaccagcgc cccctccccc gcgtgtccaa aactagtaga ggaagtggaa       600
     tatctgagtt ctcggtaccc gactttcaaa tatttgtggg ctcgtttcac ggtttcccaa       660
     ccgcgcgggc gccgggagct aaccctagtc gacaataagg gtaatgagaa atgtttcgaa       720
     ttagcatctt tccagaacat cgacgatcga tggtatcgaa ttctaatgct gatccgcccg       780
     ggtgcgactt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page