(data stored in ACNUC1104 zone)

EMBL: CP001966.PE306

CP001966.PE306       Location/Qualifiers
FT   CDS_pept        complement(322162..323295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76960"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA7"
FT                   /inference="similar to AA sequence:KEGG:CNBK0040"
FT                   /protein_id="ADG76960.1"
FT                   /translation="MEQNTLKRRGAGLIGRDAERSAGGYTLYAPLSGDGAVYLVDEDGA
FT                   EVHRWNLPYRPGRHARLLADGSLAYNGNLVGSGEGPALFDMWRKYSGGSMARYDRDGKM
FT                   LSEVVDPLQHHDAHHLDDGRILYAALEPLTGNRARAVRGGHPGTEAAGPDGTPTVYADT
FT                   IQEVGPDGELLWSWNAFDHLDVLDFPLQAHYWREHWPLINSVQPLGDDAVVASLRSVSA
FT                   VVVIDRATGDVRTVADPETVAQQHHVTPLDSGTLLVFDNGTFRHGESVTYSRVIELDPA
FT                   DGSVVWQYADNPREAFFTPFMGGAQRLWNGNTLITEAAFGRLFEVTAEGRVVWEFVVPQ
FT                   FSAYPDPSTRTVFPAVGNAVFRAYRYPAEQVQAWGLA"
     gtggaacaga acactctcaa gcgacgtggc gccggcctca tcggccggga cgccgagcga        60
     tcagccggcg gctacacgct gtacgcgccg ctgagcggcg acggcgcggt gtacctcgtc       120
     gacgaggacg gtgccgaggt gcaccggtgg aacctgccgt accgccccgg acggcacgcg       180
     cggctcctcg cggacggcag cctcgcgtac aacgggaacc tcgtcggcag cggggagggg       240
     cccgcgctgt tcgacatgtg gcgcaagtac agcggcgggt cgatggcccg ctacgaccgc       300
     gacgggaaga tgctctccga ggttgtcgac ccgctgcagc accacgacgc ccaccacctc       360
     gatgacgggc ggatcctcta cgccgcgctc gaaccgctca ccggcaaccg cgcacgcgcg       420
     gtccgcggcg gccaccccgg caccgaggcc gccggccccg acgggacgcc gaccgtctac       480
     gccgacacca tccaggaggt gggccccgac ggtgagctgc tgtggtcctg gaacgccttc       540
     gaccacctcg acgtcctcga cttccccctg caggcgcact actggcgcga gcactggcca       600
     ctgatcaaca gcgtgcagcc gctcggcgac gacgccgtgg tcgccagtct gcgcagcgtc       660
     tccgcggtcg tcgtgatcga ccgcgcgacg ggggacgtcc gcaccgtcgc cgaccctgag       720
     accgtggcgc agcagcacca cgtcacccct ctcgacagcg gaaccctcct ggtcttcgac       780
     aacgggacgt tccggcacgg ggagtccgtg acctacagcc gcgtgatcga gctcgacccc       840
     gcggacggct ccgtcgtctg gcagtacgcc gacaacccgc gcgaggcctt cttcacgccc       900
     ttcatgggag gcgcgcaacg gctctggaac ggcaacaccc taatcaccga ggccgcgttc       960
     gggcggctgt tcgaggtcac ggccgagggc cgggtggtgt gggagttcgt ggtcccgcag      1020
     ttctccgcct accccgatcc ttcgacgcga acggtcttcc ctgccgtggg gaacgcagtc      1080
     ttccgcgcct accgctatcc cgcggagcag gtccaggcct ggggcctcgc gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page