(data stored in ACNUC1104 zone)

EMBL: CP001966.PE307

CP001966.PE307       Location/Qualifiers
FT   CDS_pept        324014..324661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76961"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA8"
FT                   /inference="similar to AA sequence:KEGG:MAB_2560"
FT                   /protein_id="ADG76961.1"
FT                   /translation="MKKYVTRRFVGVIAGLGAAAVIVTGCSNASDTASSATSAAGSAAS
FT                   DATAAVGSAAASVSSAVAGATPEAKVKDSDGKEITLIGPVAAKYNAATPEQRADLGAAL
FT                   TGERSSGKRDNGVVFQQFKGGVIVAKNNNADTPAFITWGKIRDAWNVNRDTTGNPAANG
FT                   ANGSVGPLGVPTSDETTEGTVKTSTFEHGKITFDTTTGKVEVTVNGKQVAAN"
     atgaagaagt acgtgactcg tcggtttgtc ggcgtcattg caggcctcgg agccgctgca        60
     gtgatcgtga ccggatgcag caacgcgagc gataccgcgt cgtcggcgac cagcgctgcc       120
     ggcagtgccg cctcggatgc gaccgctgct gtggggagtg ctgccgctag cgtgtcctcg       180
     gcggtcgctg gcgcaacccc ggaggccaag gtcaaagatt cagatggcaa agagatcact       240
     ctgatcggtc cggtcgccgc gaagtacaac gccgctacac ctgagcagcg cgccgatctg       300
     ggcgcagcac tgactggtga acgtagttcg ggcaagcgtg acaatggcgt cgtcttccag       360
     cagttcaagg gcggggtgat cgttgcaaag aacaacaacg ctgacacgcc tgcgttcatc       420
     acgtggggca agatccgcga cgcctggaac gttaaccgcg acactacggg caacccggcc       480
     gcgaacggcg ccaacggctc cgtcggcccc ctcggcgttc ccaccagcga cgagaccacc       540
     gagggcacgg tcaagacgag caccttcgaa cacggcaaga tcacgttcga caccacgacc       600
     ggcaaagtcg aggtcaccgt caacggcaag caggtcgcag cgaactag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page