(data stored in ACNUC1104 zone)

EMBL: CP001966.PE308

CP001966.PE308       Location/Qualifiers
FT   CDS_pept        complement(324996..325427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0317"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro04775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76962"
FT                   /db_xref="GOA:D5URA9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA9"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG76962.1"
FT                   /translation="MSSESSSDLQEVNARLEAIEQRLHALEASGDAKIVSSLRTPPDDA
FT                   ASSTELPLVRISNFFSAIGNPTRLSIIRALAEGAKTPAEILSAVEIESKGKMYHHLRTL
FT                   TGTSILARTAGGAYQISSDYMARVIAEMSAVALEVTASH"
     atgtccagcg aatcatcctc tgatcttcag gaagttaacg cgcgcctaga agctattgaa        60
     caacgactgc atgcgctgga ggctagcgga gacgctaaaa tagtttcaag cctgcgaacc       120
     ccgccggatg acgccgcgtc gagcaccgaa ttgccactgg tccggatatc caacttcttc       180
     tcagccatag gaaatccgac gcgactgtct attatacgag ctctagccga aggcgcgaaa       240
     acacctgcgg aaattctgag cgccgtagaa atcgagtcga aaggaaaaat gtaccaccac       300
     ctgcgaaccc ttaccggcac ctcaatccta gcccgcaccg caggaggcgc ctaccaaatt       360
     tcgagtgact acatggcgcg tgtcattgcc gagatgagtg ctgtggcgct agaggtgacc       420
     gcgagccact aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page