(data stored in ACNUC1104 zone)

EMBL: CP001966.PE315

CP001966.PE315       Location/Qualifiers
FT   CDS_pept        336938..337228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0326"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mgi:Mflv_5460 PE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76969"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB6"
FT                   /inference="protein motif:PFAM:PF00934"
FT                   /protein_id="ADG76969.1"
FT                   /translation="MVGLNVAPIQLLSGTNEVIANVATTSGLVGGAAGTLGAVIPAGID
FT                   DVSLMVAAGSAAHAANYLAVTVVDHAAVAQYAVSLSAVAATYVAADNAVQF"
     atggtgggtt tgaacgtggc gcctattcag cttttgtctg gcactaacga agtgatcgcg        60
     aatgtcgcga ccacctcggg tctcgtgggt ggcgcggccg gaactctggg agccgtgatt       120
     ccagccggaa tcgatgatgt ctcgctcatg gtcgcggccg gatcggcggc gcacgcggcg       180
     aactatctcg cggtcaccgt cgtcgaccac gccgccgtgg cgcagtacgc cgtcagcctg       240
     tctgcggtgg cggccacgta cgtggccgcg gacaacgcgg tccagttcta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page