(data stored in ACNUC1104 zone)

EMBL: CP001966.PE317

CP001966.PE317       Location/Qualifiers
FT   CDS_pept        338675..338974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76971"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76971.1"
FT                   /translation="MIYEMNTAAHAAGTATTEQIAQATLANIKFVRTTAEAYAAANSGQ
FT                   TSLKAVAHMHEIIAVCDAEQKKLENVGISLKQNNGLITNTDMDGGDIFQGYIGL"
     atgatctacg aaatgaacac cgcggcccat gccgcaggta ccgccaccac ggaacagatc        60
     gcccaggcga ccctggcgaa catcaagttc gttcggacca ccgccgaggc ctacgccgcc       120
     gcgaactcgg gccagacctc gctcaaggca gtcgcgcaca tgcacgagat catcgcggtg       180
     tgcgacgcgg agcagaagaa gctcgagaac gtcggtatct cgctcaagca gaacaacggg       240
     ctgatcacca acaccgatat ggacggtggc gacatcttcc agggctacat cggcctctag       300
//

If you have problems or comments...

PBIL Back to PBIL home page