(data stored in ACNUC1104 zone)

EMBL: CP001966.PE318

CP001966.PE318       Location/Qualifiers
FT   CDS_pept        339014..339313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76972"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76972.1"
FT                   /translation="MPIDLIKVDYANYDTTSTLLGKSAAIADGLIAELVGNNTANLNAG
FT                   NWVGPDQGSYQDVHNACVEANERLAEVIRKAGIKVQTAATIHQAGQAQAASLYF"
     atgcccatcg atctgatcaa ggtcgactac gccaactacg acaccacgtc gaccctcctg        60
     ggcaagtccg ccgccatcgc cgacggactg atcgccgaac tcgtggggaa caacaccgcg       120
     aacctcaacg cgggcaactg ggtcggcccg gaccagggca gctaccagga cgtgcacaac       180
     gcgtgtgtgg aggcgaacga gcggctcgcc gaggtcatcc gcaaggccgg catcaaggtg       240
     cagaccgcgg cgacgatcca ccaggcaggt caggcgcagg ccgccagcct gtacttctag       300
//

If you have problems or comments...

PBIL Back to PBIL home page