(data stored in ACNUC1104 zone)

EMBL: CP001966.PE32

CP001966.PE32        Location/Qualifiers
FT   CDS_pept        complement(34322..34786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0032"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: nfa:nfa850 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76686"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR8"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG76686.1"
FT                   /translation="MQGLVLQLTRAGFLLLLWLCVWLVINALRSDARLASGLRPKQKEA
FT                   KPPRGSLFQRGSKTAKYLVVTHGPLANTRITLGQQPVLIGRADDSTLVLNDDYASTRHA
FT                   RLARDGDDWYVEDLGSTNGTYLARNKVTTPTRVPLGTPVRVGKTVIELRP"
     gtgcaaggac tcgtcctaca gctcactcgc gcgggcttcc tactactgct gtggctgtgc        60
     gtctggctgg tgatcaacgc cttgcggtcg gacgcccggc tcgcctccgg cctgcggccg       120
     aagcagaagg aagcgaagcc gccgcggggc agcctcttcc agcgcggaag caagaccgcc       180
     aaatacctgg tggtcacgca cggacctctg gccaacaccc ggatcacact cggccagcag       240
     ccggtgctga tcggccgggc cgacgactcc acgctggtgc tcaacgacga ctacgcgtcc       300
     accaggcatg cgcggctcgc ccgcgacggt gacgactggt acgtcgagga tctgggctcc       360
     acgaacggca cctatctggc ccgcaacaag gtcaccacgc ccacccgggt gccactgggc       420
     accccggtgc gcgtcggcaa gaccgtgatc gagctgcgcc cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page