(data stored in ACNUC1104 zone)

EMBL: CP001966.PE320

CP001966.PE320       Location/Qualifiers
FT   CDS_pept        340258..341997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC1"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_0067"
FT                   /protein_id="ADG76974.1"
FT                   /translation="MSDGATNVHLPFAEQNKTEGTPVPTTPQSVAGALASNAAAVRPVV
FT                   TPGPVSDEGTDSAPSTTEWEEPELPVVDDAGEAGPVPTAAEEAPAAAVADAAAVADAVA
FT                   SDDDRPTREQPVIVDEPAGRPEAEAAPTADTAAAGGQASPQGGPQVTGPQPAAQAPQQA
FT                   RTVPVPAQQPQQQWQGQAPQAQPGQHQFAQPHTGQFQQPQFAGQPPTGQFQAPVQGRPP
FT                   SPLPFGHAAPGQIAPPQPQHAGMPMRPMGESVSAPMSTASSSFQQHIRMSDSAMRVTGW
FT                   RAWLKRMGIDVGPSTSDQEHAERVHRIRVPKNKFHVTSVFADSAGGTLLVGVLGQILER
FT                   TRADNVVALDLDPDGGDLDQVTAWHQGGSTARTLIQQSDLSDRNQVDKHLAVTSTNLHV
FT                   LPTPWRFNGRDVADYDDVLDLYSIFRPHYSLALVDAGRGLQTVTGTGVLEISSALILPA
FT                   SATTRGVRKVAATIDWLRHHGWHGLLANTIVVINHTKKRGSVTVEQFDELFRAGQKLRV
FT                   HEIPYDPHLDADTPIDLDLLKPRTVRAFELLAADLADTFNSGYEPPAATKLAELQVRSH
FT                   EGR"
     atgagcgacg gtgcaacgaa cgttcacctg ccttttgcag agcagaacaa gactgagggc        60
     acaccggtgc ccaccacgcc gcagtccgtc gcgggcgcgc tggcgagtaa tgcggcggcc       120
     gtgcgacccg tggtgacccc cgggccggtg tccgacgagg gcacggattc ggcaccgtcg       180
     accacggagt gggaggaacc cgagctcccc gtcgtcgacg acgcgggcga ggccggcccc       240
     gtgcccaccg ccgccgagga agcccccgcc gccgcggtcg ccgacgccgc cgcggtcgcc       300
     gacgccgtcg cgtccgacga cgaccgaccc acccgggagc agcccgtgat cgtcgacgag       360
     ccggccggcc ggccggaggc ggaggccgcc cccaccgccg acacggcggc agcgggcggg       420
     caggcctcgc cgcagggagg cccgcaggtc accggtccgc agccggcggc gcaggcccca       480
     cagcaggcgc ggaccgtgcc cgttccggcg cagcagcccc agcagcagtg gcagggccag       540
     gccccgcagg cgcagcccgg ccagcatcag ttcgcgcagc cgcacaccgg tcagttccag       600
     cagccgcagt tcgccggcca gccgcccacc gggcagttcc aggctcccgt gcagggccgc       660
     ccgccgtcac cgctgccgtt cggccacgcc gcacccggcc agatcgcacc gccgcagccc       720
     cagcacgcgg gtatgccgat gcggccgatg ggggagtcgg tctccgcgcc gatgtccacg       780
     gcctcgtcat cgttccagca gcacatccgg atgtccgatt cggcgatgcg ggtcaccggc       840
     tggcgcgcgt ggctcaagcg catgggtatc gacgtgggcc ccagcacctc cgatcaagag       900
     catgcggagc gggtgcaccg gatccgcgtc ccgaagaaca agttccacgt caccagcgtc       960
     ttcgccgata gcgcgggcgg caccctgctg gtgggcgtgc tgggccagat tctggagcgc      1020
     acccgcgccg acaacgtggt cgcgctcgac ctcgatcccg acggcggcga tctcgaccag      1080
     gtgaccgcgt ggcatcaggg cggttcgacc gcgcgcaccc tgatccagca gagtgatctg      1140
     tcggaccgca accaggtgga caagcacctg gccgtcacgt cgacgaatct gcacgtgctg      1200
     cccaccccgt ggcggttcaa cggccgcgac gtcgccgatt acgatgacgt gctcgatctg      1260
     tactcgatat tccgcccgca ctacagcctg gcgctcgtcg atgcgggccg aggactccag      1320
     accgtcacgg gcaccggcgt tctggagatc tcttccgcgt tgatccttcc cgcctcggcc      1380
     acgacccgcg gcgtgcgcaa ggtggccgcg accatcgatt ggctgcgtca ccacgggtgg      1440
     cacggattgc tcgccaacac catcgtggtc atcaatcaca ccaagaagcg cggcagtgtc      1500
     accgtcgagc agttcgacga gctgttccgc gccggccaga agctgcgggt ccacgagatc      1560
     ccctacgacc cgcacctcga tgccgacacc ccgatcgacc tcgatctgct caagccgcgc      1620
     accgtgcgcg cgttcgagct gctcgcggcc gacctcgccg acaccttcaa ttccggatac      1680
     gagccgccgg ccgccaccaa gctggccgaa ctgcaggtgc gctcgcacga gggacgctga      1740
//

If you have problems or comments...

PBIL Back to PBIL home page