(data stored in ACNUC1104 zone)

EMBL: CP001966.PE321

CP001966.PE321       Location/Qualifiers
FT   CDS_pept        342002..343588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0332"
FT                   /product="secretion protein snm4"
FT                   /note="KEGG: msm:MSMEG_0068 transmembrane protein; TIGRFAM:
FT                   secretion protein snm4; PFAM: protein of unknown function
FT                   DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76975"
FT                   /db_xref="GOA:D5URC2"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC2"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ADG76975.1"
FT                   /translation="MAFPTTPGAPGGAPSPHQAGAAPGKPVVPEQVRVLVEVGESSVER
FT                   SLLARRRLSVVMDSVIPGLEQIFPDHDFSTAGAWTFAREGGTPLSRDKSLADAGVLDGD
FT                   RLILAETFSNQTFRPLIESTADAIQEFCRQRFRRFTSGTARTLGLIALVLGAAVFAALV
FT                   LLAWMADSSVLWWFPVAAIGSIAVITAAVSADRQYHSQQVAYALQLAAAPVLFSTGFVL
FT                   IPPDGGADGAFTAANVLTGAVFTLIGVVILGRSSGLGAAVLAGLGLVSAATVVASALFA
FT                   YTPLGRPAIPAIGVIGGLLLANWVQGWALMLARVRPDTLPPPGEDIDRSELDVAYHVDT
FT                   FDDESTTELARGDENTALERKSRTAAKLLTGFYVAVAAILVVSALTILVPDTHYFWGEV
FT                   VIAALVSVICVLRGRTLDDRVHATVFFIAGFLIAAGLAIVLVGAVGSNLARLTVIVVSA
FT                   VVLLAFGAGALLLADRVSAEEGLMAKPLSARLMGRIEFGEKTAIFVVVMLALWTTRLFA
FT                   FLRELDLSFLK"
     atggcgtttc cgaccacccc cggcgcgccc gggggcgcac cgtcgccgca tcaggccggc        60
     gccgcaccgg gtaagcccgt ggtgcccgaa caggtccggg tactggtcga ggtgggggag       120
     agctccgtcg agcgcagcct gttggcccgc cgccgcctgt cggtggtgat ggactcggtg       180
     atcccggggc tcgagcagat cttcccggac cacgacttca gcaccgccgg ggcgtggacc       240
     ttcgcccggg aggggggaac gccgctctcc cgtgacaagt cgctcgcgga tgccggtgtg       300
     ctcgacggtg atcggttgat cctggcggag accttctcga accagacgtt ccgcccattg       360
     atcgagagca ccgccgacgc gatccaggag ttctgtcgcc agcgcttccg ccggttcacc       420
     tccggcaccg cccgcaccct cggactgatc gcactggtcc tcggtgccgc ggtcttcgcc       480
     gcgctggtgc tgctcgcgtg gatggccgat tccagtgtgc tgtggtggtt cccggtggcc       540
     gcgatcggtt cgatcgccgt gatcaccgcg gccgtctcgg cagaccgcca gtaccactcg       600
     caacaggtgg cctacgcgct gcaactggcc gccgcgccgg tgctcttctc gacggggttc       660
     gtcctgatcc cgccggacgg cggcgccgac ggagcgttca cggcggccaa cgtgctcacg       720
     ggtgctgtct tcaccctgat cggcgtggtg atcctcggcc ggagcagcgg tctcggcgcc       780
     gccgtgctcg ccggcctcgg actcgtctcc gccgccaccg tcgtggccag tgcgctgttc       840
     gcctacaccc cgctgggccg accggcgatc cccgccatcg gcgtgatcgg cggtctgttg       900
     ctggcgaact gggtgcaggg ctgggcgctg atgctggccc gggtccgccc ggacacgctg       960
     cccccgcccg gcgaggacat cgacaggtcg gagttggacg tggcgtacca cgtcgacacc      1020
     ttcgacgacg agtccaccac cgaactggcc cgcggcgacg agaacaccgc gctcgagcgc      1080
     aagtcccgta ccgcggcgaa gctgctcacc ggcttctacg tggcggtcgc cgcgatcctg      1140
     gtggtctccg cgctcaccat cctggtgccc gatacccact acttctgggg cgaggtcgtg      1200
     atcgccgcgc tggtctcggt gatctgtgtg ctgcgaggtc gcacactcga cgaccgggtg      1260
     cacgccaccg tcttcttcat cgcgggcttc ctcatcgccg cggggctggc catcgtactg      1320
     gtcggcgccg tgggatcgaa cctggcgcga ctgaccgtga tcgtggtgag cgccgtggtg      1380
     ctgctcgcct tcggtgcggg cgccctccta ctggccgacc gcgtctccgc cgaggagggc      1440
     ctgatggcca aaccgctgtc ggcacggctc atgggacgca tcgagttcgg cgagaagacc      1500
     gccattttcg tggtcgtgat gctcgcgcta tggaccactc gcctgttcgc cttcctgcgt      1560
     gaactcgacc tgtcgttcct gaagtag                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page