(data stored in ACNUC1104 zone)

EMBL: CP001966.PE322

CP001966.PE322       Location/Qualifiers
FT   CDS_pept        343589..345031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0333"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: msm:MSMEG_0083 membrane-anchored mycosin
FT                   mycp1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76976"
FT                   /db_xref="GOA:D5URC3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADG76976.1"
FT                   /translation="MLASTRSLATRAAAAVAVGAIVALLGGTVPPQALAVVPPVADIGG
FT                   APPDTDGPERPLRYNNPRCVEPGVLPNSNLAAAPAPSTTLRIDEAQRFSTGAGVTVAVL
FT                   STGVRPQARLRALDGAGDNMNPADRGLLDCDSTGTLVAGIVGAQPAVGDGFVGVAPDSR
FT                   VMSIRVDSTAFALQNSPADNDDPNASRAAVTARSIARAVVRAANRGARVIVIPEPVCMA
FT                   ADAQFRQREIGGAVGYATQVKDALFVVGAGATDRNGGNTGANTCKPNPDPDPGSPDDPR
FT                   GWRRVSTVATPNWFDGQVLSVGATTAEGSPLPGSLNGPWLDVAAPGAGLVSLSSRGGDG
FT                   VVNALPADRTLVPFAGPEFAAAYVAGTAALVRSRYPQMRAKDVAARIVATAHAPGRGTD
FT                   NKVGRGLIDPVAALTAKVPEEGVDIDVQSVEKLLVPAPPPSPDTRPRRTAALVAGVGLI
FT                   VVVLVAGVVAALRPRRTGKRRS"
     atgctcgcct ccacccgatc cctcgcgacg agggccgccg ccgcggtggc ggtcggtgcc        60
     atcgtggctc tgctcggcgg tacggtgcct ccgcaggcgc tcgccgtggt tcctcccgtc       120
     gcggacatcg gtggcgcgcc gcccgacacc gacggcccgg aacgcccact gcgctacaac       180
     aatccgcgct gtgtggagcc gggggtgctt ccgaattcga acctcgcggc ggcgccggca       240
     ccgtcgacga ctctgcggat cgacgaggcg cagcggttct ccaccggcgc cggtgtcacc       300
     gttgcggtgc tgagtaccgg tgtccggcca caggcgcggc tgcgggcgct cgacggtgcg       360
     ggcgacaaca tgaacccggc cgaccgcggc ctgctcgact gcgactccac cggcacgctg       420
     gtggccggga tcgtcggcgc gcagcccgct gtgggcgacg gtttcgtcgg cgtggccccc       480
     gattcccggg tgatgtccat ccgcgtcgat tcgacggcct tcgcgctgca gaattcgccc       540
     gcggacaacg atgatccgaa cgcctcccgt gccgctgtca ccgcgcgcag catcgcccgc       600
     gccgtggtcc gcgccgcgaa ccgcggagcc cgagtgatcg tgatccccga gcccgtgtgc       660
     atggcggccg atgcgcagtt ccgccagcgc gagatcggcg gcgccgtggg ttacgccacg       720
     caggtcaagg acgcactctt cgtggtcggc gcgggcgcta ccgaccgcaa cggcggtaac       780
     accggcgcga acacctgtaa gcccaatccc gacccggacc cgggatcgcc cgatgatccg       840
     cgcggttggc ggcgggtcag caccgtcgcc actcccaatt ggtttgacgg acaggtgctc       900
     tccgtgggcg ccaccaccgc cgaaggatcc ccgttaccgg gctcgctcaa cggcccctgg       960
     ctcgacgtgg ccgcacccgg tgccggactg gtctcgctca gctcgcgcgg cggcgacggc      1020
     gtggtcaacg cactgcccgc cgaccgaacc ctggtgcctt tcgccggacc tgagttcgcc      1080
     gccgcctatg tcgcgggcac cgccgccctg gtgcgctccc ggtacccgca gatgcgtgcg      1140
     aaggacgtcg ccgcgcgcat cgtcgcgacc gcgcacgcgc ccggtcgcgg aaccgacaac      1200
     aaggtgggcc gcggactgat cgatccggtc gccgcgctca ccgcgaaggt gcccgaggag      1260
     ggggtcgaca tcgacgtcca gtccgtcgag aagctgctgg ttcccgcacc gccgccgtct      1320
     ccggacaccc gtccgcggcg gaccgcggcg ttggtcgccg gcgtcggcct gatcgtggtg      1380
     gtactggtgg ccggtgtggt cgccgcacta cggccgcggc gcaccgggaa gcggaggtcg      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page