(data stored in ACNUC1104 zone)

EMBL: CP001966.PE324

CP001966.PE324       Location/Qualifiers
FT   CDS_pept        347256..349271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0335"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mul:MUP011 transmembrane serine/threonine-
FT                   protein kinase PknQ; PFAM: Serine/threonine protein
FT                   kinase-related; tyrosine protein kinase; periplasmic
FT                   binding protein; SMART: serine/threonine protein kinase;
FT                   tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76978"
FT                   /db_xref="GOA:D5URC5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76978.1"
FT                   /translation="MAEPGEVIAGYVVESVLGTGGMGTVYRVRHRTLPRSVALKVLQSQ
FT                   FSADPSVRARFDREADIVAGLKHPHIVDVYDRGESDGHLWIAMELVEGGNVAQIVQREG
FT                   PFSLDRAVAVIEQVADALDEAHGHGILHRDVKPANFLVDRGRRGEQIKLADFGIGAAQT
FT                   EVGQHTQTGTVVGTLAYTAPEALLGNPIDHRADIYSLACAAVVLLTGAPPFNTTISGQL
FT                   MLAHISQNPPSIRVKRPDLSPEIDYVLGRAMAKNPADRYNSAGEFADALSSAARRMSGA
FT                   AGIAPPPPPAGTNWQGTPSNPALATGFNPGAPAGYSGPPPGAAVPAQFYGGPSSPSNPS
FT                   MVPPSPAKSRRPLIVGAAAAVVVLVAIAIGAFALTGGGASDGRPALDSWSARTVTDING
FT                   DTRINERPTRIVALGPGDAEIVTALGFDVVAGGNGPKSELPSWVPSLKEVPTAGTSTNP
FT                   DRAAIEKAKPDLIIDTDPAGSAASKDLKSVANSIAVSPAGSKGWTWQEQMAYIAEALGA
FT                   KDRASAVRKTYEQRITELRAAHPDFTGKKVDLVHYDGQATRLATNAASPFQLLGQLGFT
FT                   MQVPAKGSGSSWLTVASVDLYAVVNTSSVDRTVVARTDPSAGNGGYDGLPAALTYGAPI
FT                   VILDTGSGVDALLYGGPLAIDTVADDVIPAIAKGVK"
     gtggccgaac cgggtgaggt gatcgcgggg tacgtggtcg agtcggtgct gggcaccgga        60
     ggtatgggca cggtctaccg cgtgcggcac cgcacgcttc cccgatcggt ggcactgaag       120
     gtgctgcaga gtcagttctc cgccgatccg tcggtgcgcg cgcggttcga tcgcgaggcc       180
     gatatcgtgg ccgggctcaa gcacccgcac atcgtcgatg tctacgaccg cggcgagtcc       240
     gacggccatc tgtggatcgc gatggaactg gtcgagggtg gcaacgtcgc gcagatcgtg       300
     cagcgcgagg gcccgttcag cctggaccgc gccgtcgcgg tgatcgagca ggtcgccgat       360
     gcgctcgacg aggcgcacgg ccacgggatt ctgcaccgcg acgtcaaacc cgccaacttc       420
     ctcgtcgacc gcggccggcg cggcgaacag atcaaactgg cggacttcgg catcggcgcc       480
     gcgcagaccg aggtcggaca gcacacgcag accggcacgg tagtgggaac gttggcctac       540
     accgcgccgg aagcgttgtt gggcaatccg atcgatcacc gtgccgatat ctactcgctg       600
     gcgtgcgcag cggtggtgct attgaccggc gcgccgccgt tcaacaccac gatctccggg       660
     cagctcatgc ttgcgcacat cagccagaac ccgcccagca tacgggtcaa gcggcccgat       720
     ctgtcccccg agatcgatta cgtgctcggc cgcgccatgg ccaagaatcc cgccgatcgg       780
     tacaactcgg ccggtgagtt cgccgatgcg ttgtcctcgg ccgcgcgccg gatgtccggc       840
     gcggccggca tcgctccgcc gcctccgccg gctgggacga actggcaggg caccccgtcg       900
     aatcccgctc tggccaccgg gttcaatccc ggagccccgg ccgggtactc cggacctccg       960
     cccggtgccg cagtgccggc ccagttctac ggtgggccga gcagcccgag taacccgagc      1020
     atggtgccgc cgtctccggc gaagagtcgg cgtccgctca tcgtcggtgc cgctgcggcc      1080
     gtggtggtgc tcgtcgcgat cgccatcggt gcgttcgccc tcaccggtgg tggggcctcg      1140
     gacggccggc cggcgctcga ctcctggagc gcacggacgg tcacagatat caacggcgac      1200
     accaggatca acgagcggcc cactcgaatc gtggcgctcg gtcctggtga tgcggagatc      1260
     gtcaccgcgc tcggcttcga tgtggtcgcc ggtggcaacg ggccgaaatc agaactgccg      1320
     tcctgggttc cgtcgctgaa ggaggttccc acggcgggca cctcgaccaa ccccgatcga      1380
     gcggcgatcg agaaggcgaa gcccgacctc atcatcgaca ccgatccggc cggatcggcc      1440
     gcgtcgaagg atctcaaatc cgtcgcgaac agcatcgcgg tctcgccggc cggcagtaag      1500
     ggctggacct ggcaggagca gatggcctac atcgccgagg cgctcggcgc caaggatcgt      1560
     gcgtcagcgg tccgcaagac ctacgagcag aggatcaccg aactgcgcgc cgcgcacccc      1620
     gatttcaccg gtaagaaggt ggacctggtg cactacgacg ggcaggcgac gcggcttgcc      1680
     accaatgcgg cgagcccctt tcaactactg gggcagctcg gcttcaccat gcaggtgccg      1740
     gccaagggca gcggatcgtc gtggttgacg gtggcatcgg tggatctgta tgcggtggtg      1800
     aacaccagct cggtggaccg cacggtagtg gcacggaccg atccgagcgc cgggaacggc      1860
     ggttacgacg ggcttccggc cgcactgacc tacggtgcgc cgatcgtcat tctggacacg      1920
     ggctccggag tggatgccct gctgtacggc ggaccgctgg ccatcgatac cgttgccgat      1980
     gatgtgatcc cggcgattgc gaagggagtc aaatag                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page