(data stored in ACNUC1104 zone)

EMBL: CP001966.PE327

CP001966.PE327       Location/Qualifiers
FT   CDS_pept        350611..351162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0338"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cai:Caci_2169
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76981"
FT                   /db_xref="GOA:D5URC8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADG76981.1"
FT                   /translation="MNALVVIDVQESFRQRANWSEVSNPGIVGDVNRLVVAARERGEPV
FT                   VWILHSEPGSGGVFDPASGHVVLQPGLVPLPGEPLLTKTTRNAFTSTELGRLLQRGGVT
FT                   GLTIAGIQTEQCCETTARLAADLGFDVDFVTEATATFPIVRPDTGAVLGTDAIIERTEF
FT                   ALAGRFARIRTLDEAVAGAA"
     atgaacgcac tcgtggtgat cgatgtccag gagtccttcc gtcagcgcgc gaactggtcc        60
     gaggtctcga atcccggcat cgtcggtgat gtgaaccggc tcgtcgtggc ggcgcgtgag       120
     cggggcgaac cggtcgtgtg gatcctgcac agcgaaccgg gaagcggtgg cgtattcgac       180
     ccggcgtcgg gtcacgtcgt gctgcagccg gggctcgtgc cgctgcccgg agaacccttg       240
     ctgaccaaga ccacgcgcaa tgccttcacc agcaccgaac tcgggcgact gctccagcgc       300
     ggcggcgtca ccggcctcac gatcgcgggt atccagaccg agcagtgctg cgagacgacg       360
     gcgcggctgg ccgcggatct cggcttcgac gtggacttcg tcaccgaggc caccgccacc       420
     ttcccgatcg tgcgcccgga taccggtgcg gtcctcggga cggacgcgat catcgagcga       480
     accgaattcg cgctcgcggg ccgcttcgcg cggatccgca cgctcgacga ggcggtcgcg       540
     ggcgcggcat ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page