(data stored in ACNUC1104 zone)

EMBL: CP001966.PE330

CP001966.PE330       Location/Qualifiers
FT   CDS_pept        353423..354634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0341"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   svi:Svir_30250 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76984"
FT                   /db_xref="GOA:D5URD1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG76984.1"
FT                   /translation="MSDAFIYEAIRTPRGKLKGGSLTAIKPTDLVVGLIDEIKDRNPDL
FT                   DPAAVDDIVLGVVSPVGEQGADIARTASIVAGLPDTVAGVQINRFCASGLEATNMAAQK
FT                   VGSALGDDLVLAGGVESMSRVPMGSDFGALFYDPQYSYDNYIAPQGIGADLIATIEGFS
FT                   RDDVDQYSAQSQELAAKAWDEGRFAKSVVPVKDQNGLVVLDNDEHRRPGTTAADLGKLR
FT                   PAFTVVGEMGGFDAVALQKYTHVEKIDHVHTGGNSSGIVDGAALVLVGNEAGGKKAGLT
FT                   PRGRIVATASTGADPTIMLTGPTPATEKVLAKAGLTKDDIDVWELNEAFASVVLKWMKD
FT                   FKLDREQVNVNGGAIALGHPLGATGAMLVGTVLDELERTGGRYGLITLCIAGGMGSATI
FT                   IERI"
     gtgtctgacg cattcatcta cgaggcgatc cgtacgccgc gtggcaagct caagggcggc        60
     tcgctgaccg ccatcaagcc caccgacctc gtggtggggc tcatcgacga gatcaaggac       120
     cggaaccccg atctggatcc ggccgccgtc gacgacatcg tgctgggcgt cgtctcgccg       180
     gtcggcgagc agggcgccga catcgcgcgc accgcctcca tcgtggccgg cctcccggac       240
     accgtcgcgg gtgtgcagat caaccgcttc tgcgcctcgg gtctcgaggc caccaatatg       300
     gcggcccaga aggtcggttc ggcgctcggc gatgacctgg tcctcgccgg cggtgtcgag       360
     tcgatgtcgc gcgtgccgat gggctccgac ttcggcgccc tgttctacga cccgcagtac       420
     agctacgaca actacatcgc gccccagggc atcggtgccg acctcatcgc caccatcgag       480
     ggcttctccc gcgatgacgt cgatcagtac tccgcgcagt cccaggagct cgccgcgaag       540
     gcgtgggacg agggccggtt cgccaagtcc gtcgtgcccg tcaaggacca gaacggcctc       600
     gtcgtgctcg ataacgacga gcaccgtcgt cccggcacca ccgccgccga cctgggcaag       660
     ctgcgtcccg ccttcaccgt ggtcggtgag atgggcggct tcgacgccgt ggcgctgcag       720
     aagtacaccc acgtcgagaa gatcgaccac gtgcacaccg gcggtaacag ctccggcatc       780
     gtcgacggtg cagccctcgt gctggtcggc aacgaggccg gcggtaagaa ggccgggctc       840
     accccgcgcg gccgcatcgt cgcgaccgcc tcgaccggcg ccgatccgac gatcatgctg       900
     accggtccca cgccggccac cgagaaggtg ctggccaagg ccgggctgac caaggacgac       960
     atcgacgtct gggagctcaa cgaggccttc gcctccgtgg tcctgaagtg gatgaaggac      1020
     ttcaagctcg accgcgagca ggtcaacgtc aacggcggcg cgatcgcgct gggtcacccg      1080
     ctgggcgcca ccggcgcgat gctggtgggc accgtgctcg acgagctcga gcgcacgggc      1140
     ggccgctacg gcctgatcac cctgtgcatc gccggcggca tgggctcggc caccatcatc      1200
     gagcgcatct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page