(data stored in ACNUC1104 zone)

EMBL: CP001966.PE331

CP001966.PE331       Location/Qualifiers
FT   CDS_pept        354669..356861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0342"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: mab:MAB_0851 fatty
FT                   oxidation protein FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76985"
FT                   /db_xref="GOA:D5URD2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADG76985.1"
FT                   /translation="MSDNMIRWEQDADGIVTLTMDDPNSSANTMNELYGTSMRATVDRL
FT                   EAEVDSITGVVLTSAKKTFFAGGNLTEIRKATKADAQQVFDNVQEIKKDLRRLEKLPKP
FT                   VVAAINGAALGGGLEIALAANHRIAADVKGSKIGLPEVSLGLLPGGGGVTRTVRMLGLQ
FT                   GALMGVLLQGQQMAPGKAQKTGLVNDLVGTVEELVPAAKAWIKANPEAATQPWDVKGHR
FT                   IPGGSPIDKTLAPNAPAFPANLRKQLKGAPMPAPEAIMAAAFEGTYVDFDTALEIESRY
FT                   FTKLATGQVSKNMIKAFFFDLQHINGGGSRPDGYEKYQAKKVGVIGAGMMGAAIAYVSA
FT                   KAGIEVVLKDIDQAAADRGKDYSVKLEEKALAKGRTTQEKSDALLARIHPTVDPQDFAG
FT                   VDLVIEAAFESVEVKNKVFQEIEDIVEPDAILGSNTSTLPITILAEGVKRSEDFIGIHF
FT                   FSPVDKMPLVEIIKGEKTSDAVLAKVIDYTLQIKKTPIVVHDSRGFFTSRVIGTFINEA
FT                   LAAIGEGVDPVYLEQAGQQAGYPAAPLQLTDELTLTLMQKIRKATEDALTAEGKPVPQH
FT                   GAFAVVDWMVENGRTSKKDGAGFYDYADGKRTGLWKGFQEHFKSGSVTPDFAELQERML
FT                   FIESIETVRCFDEGVLESVADANIGSIFGIGFPAWTGGVLQYINGYEGRPGTPAEGLTG
FT                   PKAFVAQANALAAKYGEQFTPPESLVAKAEAGETYE"
     atgtctgaca acatgattcg ctgggagcag gacgccgacg gcatcgtcac gctgacgatg        60
     gacgatccga acagctccgc gaacacgatg aacgagctgt acggcacctc gatgcgggcc       120
     accgtggatc gcctcgaggc cgaggtcgac agcatcaccg gtgtcgtgct cacctccgcg       180
     aagaagacct tcttcgccgg tggcaacctg accgagatcc gcaaggccac caaggccgat       240
     gcgcagcagg tcttcgacaa cgtccaggag atcaagaagg atctgcgccg cctggagaag       300
     ctgcccaagc ccgtcgtggc cgccatcaac ggcgccgctc tgggcggtgg cctggagatc       360
     gccctggccg ccaaccaccg catcgcggcg gacgtcaagg gcagcaagat cggccttccc       420
     gaggtcagcc tcggcctgct ccccggtggt ggcggcgtga cccgcaccgt gcggatgctg       480
     ggcctgcagg gcgctctcat gggcgtgctg ctccaggggc agcagatggc tccgggcaag       540
     gcccagaaga ccggcctggt gaacgatctg gtcggcaccg tcgaggagct cgtccccgcc       600
     gcgaaggcgt ggatcaaggc gaaccccgag gccgcgacgc agccgtggga tgtcaaggga       660
     caccgcatcc ccggtggctc gccgatcgac aagacgctgg cccccaacgc cccggcgttc       720
     ccggccaacc tgcgcaagca gctcaagggt gcgcccatgc ccgcaccgga ggccatcatg       780
     gccgccgcct tcgagggcac ctacgtcgac ttcgacaccg cgctcgagat cgagtcgcgc       840
     tacttcacca agctggccac cggtcaggtg tcgaagaaca tgatcaaggc gttcttcttc       900
     gatctgcagc acatcaacgg tggcggtagc cgtcccgatg ggtacgagaa gtaccaggcc       960
     aagaaggtcg gcgtgatcgg cgccggcatg atgggcgcgg ccatcgcgta cgtctcggcg      1020
     aaggccggta tcgaggtggt cctcaaggac atcgatcagg ccgccgcgga tcgcggtaag      1080
     gactacagcg tcaagctgga ggagaaggcg ctcgccaagg gtcgcaccac tcaggagaag      1140
     tccgacgccc tgctcgcccg catccacccg accgtggatc cgcaggactt cgcgggtgtc      1200
     gatctcgtca tcgaggccgc gttcgagtcc gtcgaggtca agaacaaggt cttccaggag      1260
     atcgaggaca tcgtcgaacc cgacgccatc ctgggctcga acacctcgac cctgccgatc      1320
     accatcctcg ccgagggcgt caagcgctcc gaggacttca tcggcatcca cttcttctcc      1380
     cccgtggaca agatgcccct ggtcgagatc atcaagggcg agaagacctc cgacgccgtg      1440
     ctggccaagg tgatcgacta caccctgcag atcaagaaga ccccgatcgt ggtgcacgac      1500
     agccgcggct tcttcacctc ccgtgtgatc ggcaccttca tcaacgaggc gctcgccgcc      1560
     atcggtgagg gcgtcgaccc ggtgtacctg gagcaggcgg gccagcaggc cggctacccg      1620
     gccgcgccgc tgcagctgac ggacgagctc acgctcaccc tgatgcagaa gatccgcaag      1680
     gccaccgagg atgcgctcac cgctgagggc aagccggttc cgcagcacgg tgccttcgcc      1740
     gtggtcgact ggatggtcga gaacggccgc acctccaaga aggacggtgc gggcttctac      1800
     gactacgccg acggtaagcg caccggcctg tggaagggct tccaggagca cttcaagtcg      1860
     ggcagtgtga cgccggactt cgccgagctc caggagcgca tgctgttcat cgagtcgatc      1920
     gagaccgtgc gctgcttcga cgagggcgtg ctggagtcgg tcgcggatgc caacatcggc      1980
     tccatcttcg gcatcggctt ccccgcgtgg accggtggcg tgctgcagta catcaacggc      2040
     tacgagggcc gcccggggac gcccgccgag ggcctcaccg gtccgaaggc cttcgtcgcg      2100
     caggcgaacg ccctggcggc caagtacggc gagcagttca ccccgccgga gtcgctggtg      2160
     gccaaggctg aggcgggcga gacctacgag tag                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page