(data stored in ACNUC1104 zone)

EMBL: CP001966.PE333

CP001966.PE333       Location/Qualifiers
FT   CDS_pept        complement(357676..358293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gox:GOX1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76987"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD4"
FT                   /inference="similar to AA sequence:KEGG:GOX1008"
FT                   /protein_id="ADG76987.1"
FT                   /translation="MASEENVVLLTWPTTAPAYEAQSRLTELGNSGAVEVRESAVVERG
FT                   ADGTLTVPQGDSGTVGLATLGGSTLGVLVGVLGGPVGALLGWASGALIGGAWDLSRADD
FT                   SDSVIAALSSSIPPGANALLADVVEGSHDAIDGLAARSGARLVRKPTGEVLDEIDASEE
FT                   AADEAAAAARKKVREEKKADRSADRHARVDKLKEKLNISSGS"
     gtggcttcag aggagaacgt cgtcctactg acgtggccca ccacggcacc cgcgtacgag        60
     gcgcagagcc gactcacgga gctcggcaac tccggcgccg tcgaggtccg cgagtccgcg       120
     gtcgtcgagc gcggtgccga cggtacgctc accgttccgc agggcgattc cggcaccgtc       180
     ggcctcgcca cgctcggcgg cagcaccctc ggagtgctgg ttggagtact cggcggcccc       240
     gtgggcgccc tgctcggctg ggccagcggc gcactcatcg gcggcgcctg ggacctttcc       300
     cgcgccgacg attcggactc ggtgatcgcc gccctgtcca gctcgatccc gccgggcgcc       360
     aatgccctgc tcgccgatgt ggtcgagggc tcgcacgatg cgatcgacgg gctcgccgcg       420
     cgctccggcg cccgtctggt gcgcaagccg accggcgagg tgctcgacga gatcgacgct       480
     tccgaggagg ccgccgacga ggccgccgcg gcggcccgca agaaggtccg cgaggagaag       540
     aaggccgacc ggtcggccga ccgacacgcc cgcgtggaca agcttaagga aaagctgaac       600
     atctccagcg gatcgtaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page