(data stored in ACNUC1104 zone)

EMBL: CP001966.PE336

CP001966.PE336       Location/Qualifiers
FT   CDS_pept        361672..363732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0347"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: nfa:nfa51880 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76990"
FT                   /db_xref="GOA:D5URD7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD7"
FT                   /inference="protein motif:PFAM:PF02129"
FT                   /protein_id="ADG76990.1"
FT                   /translation="MILNRLGRALTALLAVTVIVAGAAVPALRAPAAAEPWKPGAGVAG
FT                   MINPEWIASHDGPSQYPRMATEWDVPIRMSDGTVLRANIFRPADASGKAIETAMPTIVN
FT                   MTPYTKFISTIVTLVTNVPVLYPALVGLLNLFNFSGTPIAGVDDLRNTLNGGLLNTFTV
FT                   DQKLVQSGYTQVVVDVRGTGNSQGVWQVFAQREQQDTVEVLDWIRKQSWTNGRFGMAGV
FT                   SYSAINQLQVASKNPEGLQALFPVVPGADIAADIVAPGGGLGVGFIGPWLAMVNILKFI
FT                   PDLRSLLNGTFDWKWLQDRLQNPAVFVPELLTGVFSPTVEGLTPTTKELINKDSTLRAA
FT                   FQTPLDKVTTPTFALGGWNDLFTNTEWRLPTALSALSTAKKKLIMGDAAHVTVTNDMGG
FT                   VGQPTRADVLQKAWFDKWLKDADNGIDNYAPVTVHRMGGGWWQGDTFPEPEQKYQRMYL
FT                   SSLPSGTAPTALSDNSLQTSPPKVPARRTVGPGLSTLCSNDTGQAMFGLLVFQGCTKDN
FT                   RVAEMNALTFTSKPVGKPTVISGPINLRLNTTQDAKDAYWSVMVTDVGPDGRSEKISSG
FT                   QLTTSLRQIDESRSTRTAGGDMVDPYYKLNLADRQLVAPGQVVPLDIGTHAVSAVLKPG
FT                   HRLRVDVFALNLIKAMTVGPVTAETQFRPQHVLIDPKQPSYLVVPSDRPLP"
     atgattctga atcggctcgg gcgcgcgctc accgcgctcc tcgcagtaac cgtgatcgtc        60
     gccggagcgg cggtgcccgc actgcgcgcg ccggcggccg cggaaccgtg gaagccgggt       120
     gccggtgtgg cggggatgat caatccagag tggatcgcct cgcacgacgg cccttcgcag       180
     tacccgcgga tggccaccga gtgggatgtt cctattcgca tgtccgacgg cactgtattg       240
     cgcgccaaca tcttccggcc cgccgatgcg tccggcaagg cgatcgagac cgcgatgccg       300
     acgatcgtca acatgacgcc ctacaccaag ttcatcagca ccatcgtgac attggtgacc       360
     aacgtcccgg tgctgtatcc ggcactggtg ggactgctca atctgttcaa cttctccggc       420
     acgccgatcg ccggggtgga cgatctgcgc aacacgctca acggtggcct gctcaacacc       480
     ttcaccgtgg atcagaagct ggtacagagc gggtacaccc aggtggtggt ggacgtgcgc       540
     ggcaccggca attcgcaggg cgtgtggcag gtcttcgctc agcgcgagca gcaggacacc       600
     gtcgaggtgc tggactggat tcgcaagcag agctggacca acggccggtt cggtatggca       660
     ggcgtgtcgt attcggcgat caaccagttg caggtggcgt cgaagaatcc cgagggacta       720
     caggccctgt tcccggtggt gcccggcgcc gatatcgccg cggacatcgt ggcgcccggc       780
     ggcgggctcg gcgtcggctt catcggtccc tggctcgcca tggtcaacat cctcaagttc       840
     attcccgatc tccggtcgct gctcaacggc accttcgatt ggaagtggtt gcaggacagg       900
     ctgcagaacc ccgcggtgtt cgtccccgag cttctcaccg gtgtcttctc gcccaccgtg       960
     gagggcctca ccccgaccac gaaggaactg atcaacaagg actcgacgct gcgcgccgcc      1020
     ttccagacgc ctctggacaa ggtgaccacg cccacgttcg cgctcggtgg ctggaacgac      1080
     ctgttcacca acaccgaatg gcgtctgccc acggcgctga gtgcgctgtc cacggccaag      1140
     aagaagctca tcatgggcga cgccgcacac gtcaccgtca ccaacgatat gggcggagtg      1200
     gggcagccga cccgtgccga cgtcctgcag aaggcgtggt tcgacaaatg gctcaaggac      1260
     gccgataacg gtatcgacaa ctatgcgccg gtcacggtgc accggatggg tggcggctgg      1320
     tggcaagggg acaccttccc cgagcccgag cagaagtacc agcgcatgta cctctccagc      1380
     ctgccctcgg gtaccgcccc gacggcgctc tcggacaaca gtcttcagac gtcacctccg      1440
     aaggttccgg cgcgccgcac ggtggggccg gggctgtcga cgctgtgctc gaacgacacc      1500
     ggccaggcga tgttcggtct gctggtattc caggggtgca ccaaggacaa tcgcgtcgcc      1560
     gagatgaacg cgctcacctt cacctccaag ccggtgggca agccgaccgt gatctccgga      1620
     ccgatcaacc tgcggctcaa cacaacccag gacgccaagg acgcctactg gagcgtgatg      1680
     gtcaccgacg tcggccccga cggcaggtcc gagaagatca gctccggtca gctcaccacc      1740
     tcgctgcggc agatcgacga atcccgcagc acccgcactg cgggtggaga catggtcgat      1800
     ccgtactaca aactcaatct cgccgaccgg cagctggtag cccccggaca ggtggtgccg      1860
     ctcgacatcg gcacccacgc cgtgagtgcc gtgctcaaac ccgggcaccg gctgcgtgtc      1920
     gatgtcttcg cgctcaatct gatcaaggcg atgaccgtcg gaccggtgac cgcggagacg      1980
     cagttccggc cgcagcacgt actgatcgat ccgaagcagc ccagctacct ggtggtgcca      2040
     tcggatcggc ccctgccgtg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page