(data stored in ACNUC1104 zone)

EMBL: CP001966.PE338

CP001966.PE338       Location/Qualifiers
FT   CDS_pept        364553..366175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0349"
FT                   /product="penicillin-binding protein"
FT                   /note="KEGG: rer:RER_10670 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76992"
FT                   /db_xref="GOA:D5URD9"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD9"
FT                   /inference="similar to AA sequence:KEGG:RER_10670"
FT                   /protein_id="ADG76992.1"
FT                   /translation="MRPSVGRRTGAAALVSLLLLTLAACGDDETADVTKMLDGYAAAIG
FT                   ERNAVAAAGFTSSPDAASGVIGRTLRDMRPEKVSVKAQNVQRYSGGNATFDLKTQWNFG
FT                   KGRDWEYTTKGSASSLSIGWRISWDPAVLAPGLTTSTAIRQIRTDARPPKVFARDNSEL
FT                   MFAGTVHKLTVDPNQTTNLTDSLTRVAKIVAPVAPLVTPESLAAKAKADPGKPVPVVDL
FT                   RGDDYAVLEDKLKAVPGLRDTEAPDLLIANRQLFSPLFTGIKGAWQANRDATAGWAVQL
FT                   VTEEKPPTQVVGFQGPPGPDLKTSMDPKVQLAAENAVVQLGQPAAMVVVSISSGAVLAA
FT                   AQNNQASLESPDWALTGLSTTGPVLAPVYSEVNSAAGKDTGKQAGLLSPLGLGTAFAMT
FT                   GVTTVTAELPGTGGRPAAELGADTMKASPFGLAVFASAIAKGKTTAPYVVQGQTATPSA
FT                   PMGDVDGTILAAVRAKMEATVSPSGDGSDLVSSKVKGLVGTNGPQGPGWFVGYRGDQAF
FT                   AIMVSGERSGSGSLQVAGSYLTQ"
     gtgagaccga gcgtggggcg acgtaccggg gctgccgcgc tggtctctct cctgctcctc        60
     acgctcgctg cctgcggcga cgacgagacc gcggacgtca cgaagatgct cgacggatac       120
     gccgccgcga tcggcgagcg caatgcggtg gccgcggcgg gcttcacctc ctcgccggat       180
     gccgcgagcg gcgtgatcgg ccggaccctg cgcgatatgc ggcccgagaa ggtgagcgtc       240
     aaggcccaga acgtgcagcg ctactccggc ggtaacgcca ccttcgatct gaaaacgcag       300
     tggaacttcg gcaagggccg cgactgggag tacaccacca agggcagcgc gtcgagtctg       360
     tcgatcggct ggcgcatctc ctgggatccc gccgtgctcg ctcccggcct caccaccagc       420
     accgcgatcc ggcagatccg caccgacgcc cgtcctccga aggtgttcgc ccgggacaac       480
     tccgagctga tgttcgccgg taccgtgcac aaactcaccg tcgacccgaa ccagaccacg       540
     aacctcaccg acagtctgac ccgggtcgcg aagatcgtgg ccccggtcgc gccactggtg       600
     acaccggaga gcctcgcggc gaaggccaag gccgatcccg gtaagccggt gccggtggtg       660
     gacctgcgcg gcgatgacta cgcggtgctc gaggacaagc tcaaggcggt gcccggcctg       720
     cgggataccg aggcacccga tctgctgatc gccaaccggc agctgttctc cccgctgttc       780
     accgggatca agggggcctg gcaggccaac cgcgacgcca ccgcagggtg ggcagtgcag       840
     ttggtgacgg aggagaagcc gcccacgcag gtggtggggt tccaggggcc gcccggtccc       900
     gatctgaaga cctcgatgga ccccaaggtg caactcgcgg ccgagaacgc cgtggtccag       960
     ctgggccagc ccgccgcgat ggtcgttgtc tccatcagca gcggcgccgt cctcgccgcg      1020
     gcccagaaca accaggccag tctggaatcg ccggactggg cgctcaccgg tctctccacc      1080
     accggccccg tgctggcgcc ggtgtactcc gaggtgaact ccgccgccgg caaggacacc      1140
     ggtaagcagg cgggactgct gtcgccgctc gggctgggca ccgccttcgc gatgacgggg      1200
     gtcacaaccg tgaccgccga gctgcccggc accggcggcc ggcccgccgc cgaactcggc      1260
     gccgacacca tgaaggcctc gcccttcggg ctcgcggtgt tcgcgtcggc gatcgcgaag      1320
     ggcaagacca ccgcgcccta cgtcgtgcag gggcagaccg ccacgccgag cgccccgatg      1380
     ggcgatgtcg acggcacgat cctcgcggcg gtgcgcgcga agatggaggc caccgtgtca      1440
     ccgtcgggcg acggcagtga cctggtgtcc agcaaggtga aggggctggt cggtacgaac      1500
     ggtccgcagg gaccgggctg gttcgtcggc taccggggcg accaggcctt cgcgatcatg      1560
     gtcagcggcg aacggtcggg cagcggatcg ctgcaagtcg ccggttccta cctcacgcag      1620
     tag                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page