(data stored in ACNUC1104 zone)

EMBL: CP001966.PE342

CP001966.PE342       Location/Qualifiers
FT   CDS_pept        369344..370549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0353"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mkm:Mkms_3090 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76996"
FT                   /db_xref="GOA:D5URE3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76996.1"
FT                   /translation="MDGTVSRLRRVVPTGRDDESHRPGDDDPRAPLWRGAQYFRAISVI
FT                   YAVGRHIDEAGRYERIGWSWVLIGLLVAFSALAALAYVRGFGRNRWFVGGEFVVAAALA
FT                   LSTWLVASPGFTQFNQALPTTLWLTNPVVSAAILGGPVAGLIGGVVIAAVNAIYRDVFP
FT                   ESTLRDANYPVFMSVGLGLGVAARMATKSREQVRAAERVAAEARARERLAREVHDGVLQ
FT                   ALAFLSRRCAELGGAATALGELAAQQERALRRLIAESPDTAGPDEAGGTVDLRELVRPL
FT                   ATAARSPVTLAEPGGPVALPAGTAAEVAAAVRNALDNTARHAGPGVRAFLLIEDVGDAV
FT                   LVTVRDDGTGIAPGRLDEARAEGRLGVSESIVGRIRALGGRAELTTDIGEGVEWELWVP
FT                   RN"
     atggatggca ccgtgtcccg gctgcggcgc gtcgtaccca ccggacgcga cgacgagtcg        60
     caccggcccg gcgacgacga cccccgggca ccgctgtggc ggggtgcgca gtacttccgc       120
     gcgatctccg tgatctacgc cgtgggacga cacatcgacg aggccgggcg gtacgagcgg       180
     atcgggtgga gctgggtgct gatcgggctg ctcgtggcct tcagcgcgct cgcggccctc       240
     gcctatgtgc gcgggttcgg ccggaaccgg tggttcgtgg gcggggagtt cgtggtcgcg       300
     gcggcgttgg cattgtcgac gtggctcgtg gcctcgcccg gtttcacgca gttcaatcag       360
     gcgctgccga ccacgctgtg gctcaccaac ccggtggtct cggccgcgat cctcggtggc       420
     cccgtcgcgg gactgatcgg cggcgtcgtg atcgccgcgg tgaacgcgat ctaccgggac       480
     gtgtttccgg agagcacgct gcgcgatgcc aactacccgg tgttcatgtc cgtgggcctg       540
     gggctgggcg tggccgcacg gatggccacc aagtcccgcg agcaggtgcg cgctgccgaa       600
     cgagtcgccg cggaggcccg ggcccgggag cggctggccc gggaggtgca cgacggggtg       660
     ctccaggcgc tggccttcct gtctcggcgg tgcgctgagc tcggcggtgc ggcgaccgca       720
     ttgggcgagc tggccgcaca gcaggagcgc gcattgcgcc ggctcatcgc cgagagcccc       780
     gatacggctg gaccggacga ggccggcggc accgtcgacc tgcgggagct ggtgcgcccg       840
     ctggccactg ccgcgcggag cccggtgacc ctggccgagc ccggcggtcc ggtggccctg       900
     cccgcgggta ccgccgcaga ggtggcggcc gctgtccgga acgcgctcga caacaccgcc       960
     cggcatgccg ggcccggtgt acgcgccttc ctcctcatcg aagacgtcgg ggacgccgtg      1020
     ctcgtgacgg tgcgcgacga tggcacagga atcgcaccgg gacggctcga tgaagcgcgc      1080
     gcggagggca gactgggtgt atcggagtcg atcgtgggcc ggatacgggc actgggtggc      1140
     cgcgccgaac tcaccaccga tatcggagaa ggggtggagt gggaactgtg ggtacctcgg      1200
     aactag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page