(data stored in ACNUC1104 zone)

EMBL: CP001966.PE343

CP001966.PE343       Location/Qualifiers
FT   CDS_pept        370522..371190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0354"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: rop:ROP_52210 putative NarL family two-
FT                   component response regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; Sigma-70 region 4 type
FT                   2; SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76997"
FT                   /db_xref="GOA:D5URE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG76997.1"
FT                   /translation="MGTVGTSELDDAAIRVLVVDDHPMWRDAVARDLEARGFTVAGTAD
FT                   SVAAAGRIAGAVQPTVVLMDMSLPDGDGAAGTTLVLQHAPQAAVLILSASDEREDVVEA
FT                   VKAGACGYLVKSASAEELVAAVRATAAHQPVFTPGLAGLVLGEFRRMAAEPEPAGPQLT
FT                   PRETEVLRLVAKGLSAKQIATRLHLSHRTVENHVQATLRKLQLGNRVELARYALENGLD
FT                   "
     gtgggaactg tgggtacctc ggaactagac gatgcggcga tccgtgtact ggtggtcgac        60
     gatcacccga tgtggcgcga cgccgtggcc cgcgacctgg aggcacgtgg cttcaccgtg       120
     gcgggtacgg ccgattcggt ggcggccgcc ggccggatcg cgggcgcagt gcagccgacc       180
     gtggtgctga tggacatgtc gctgcccgat ggtgacggtg ccgccgggac cacactggtg       240
     ctccagcacg caccgcaggc cgcggtgcta atcctctcgg cttcggacga acgcgaggac       300
     gtggtcgagg ccgtgaaggc cggagcctgc ggctatctgg tcaagagtgc ttcggccgag       360
     gaattggtgg cggcggtccg cgccaccgcg gcgcaccagc cggtgttcac ccccggtctg       420
     gccggactgg tgctcggtga attccggcgc atggccgccg aacccgagcc ggccggcccg       480
     cagctcactc cccgcgagac cgaggtgctg cggctggtgg cgaaaggctt gtccgccaag       540
     cagatcgcca cccgattgca tctgagtcac cgtactgtcg agaaccacgt gcaggcgacg       600
     ctgcgcaagc tccaactcgg gaaccgagtg gagctcgcgc ggtacgcctt ggagaacggc       660
     ctggactag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page