(data stored in ACNUC1104 zone)

EMBL: CP001966.PE344

CP001966.PE344       Location/Qualifiers
FT   CDS_pept        complement(371187..373244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0355"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: mgi:Mflv_2852 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase; heavy
FT                   metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76998"
FT                   /db_xref="GOA:D5URE5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE5"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADG76998.1"
FT                   /translation="MNHSGMNHASMDHTALDHTATDHGGGHGGHGDHVAQFRRLFWIML
FT                   MLAVPVVALSDMFAMIAGYSLPAVPGLAWVSPILGTVMYVWGGRPFLTGAVSEIKARRP
FT                   GMMLLIGLAITVAFVASWGASLGLLHHQLDFWWELALLIVIMLLGHWIEMRSLARTTSA
FT                   LDSLAALLPEEAERIEDGAVVIVAPSELRVGDVVVVRPGGSVPADGAVVEGRAAMDESM
FT                   ITGESQTVERTVGETVTAGTVATDSGLRVRVTATGDDTALAGIGRLVEQAQNSTSRAQA
FT                   LADRAAGWLFWYALGAGALTAAVWTVLGEPDQAVIRTITVLVIACPHALGLAIPLVVSI
FT                   ATERAAKAGVLVKDRMALETMRTVDTVLFDKTGTLTRGEPVVTEIVGGGEVLALAAAAE
FT                   ADSEHPLARAIVRSARDRGLTVPAATGFTSSPAVGVTAVVDGATIRVGGPNLLAEENVR
FT                   ELPAADAWRERGAIILHVLRDGAVIGALALADEVRPESREAVDALHALGIQVVMITGDA
FT                   EAVAHAVADELCIDRVYAGVRPEDKAAKVAELQGETRIVAMVGDGVNDAPALAQANVGL
FT                   AIGAGTDVAIASAGVILAGDDPRSVLSVIELSHASYRKMKQNLWWAAGYNLISVPLAAG
FT                   VLAPIGFVLPMSVGAILMSLSTVVVALNAQLLRRLDLRPQTVTARILQRR"
     atgaaccaca gcgggatgaa ccacgcgtcg atggatcaca cagccctgga tcacacggcg        60
     accgatcacg gcggcggcca cggcggccac ggcgatcatg tggcccagtt ccggcggctg       120
     ttctggatca tgctgatgct ggccgttccg gtggtggcgc tctcggacat gttcgcgatg       180
     atcgccgggt actccctacc ggccgttccg ggcctggcgt gggtctcccc gatcctcggc       240
     acagtgatgt acgtctgggg tggacgcccg ttcctcaccg gtgcagtctc cgagatcaag       300
     gcccgccggc ccggaatgat gctgctgatc gggctggcta tcaccgtggc tttcgtcgcc       360
     tcctggggcg ccagcctggg cctgctgcac caccagctcg acttctggtg ggagctggca       420
     ctgctcatcg tgatcatgct gttgggccac tggatcgaga tgcgctcact ggcccgaacc       480
     acctccgcgc tggactcgct cgccgcgcta ctgcccgagg aggccgaacg catcgaggac       540
     ggtgcggtcg tcatcgtggc accgtcggag ctgcgcgtgg gcgatgtggt cgtggtccgc       600
     cccggcggca gcgtgcccgc ggacggcgcg gtggtcgagg gccgcgccgc catggacgaa       660
     tcgatgatca ccggcgaatc gcagaccgtg gagcggaccg tgggcgagac cgtgaccgcg       720
     ggtaccgtcg ccaccgattc cggtctgcgc gtgcgggtca ccgccaccgg cgacgacacc       780
     gcgctcgcgg gaatcggccg gctggtggaa caggcgcaga actccacatc gcgggcacag       840
     gcactcgccg atcgggccgc gggctggctg ttctggtacg ccctgggggc cggcgcgctc       900
     accgccgcgg tctggacggt gctcggcgag cccgatcagg ccgtgatccg caccatcacc       960
     gtgctggtga tcgcatgccc gcacgccctc ggcctggcga tcccgctcgt ggtctcgatc      1020
     gccaccgaac gcgccgcgaa ggcaggcgtg ctggtcaagg accggatggc gctggagacc      1080
     atgcgcaccg tggacaccgt gctcttcgat aagaccggca cgctcacccg cggcgagccc      1140
     gtcgtgaccg agatcgtggg cggcggcgag gtgctcgcgc tggccgcggc ggccgaggcg      1200
     gacagcgagc acccccttgc gagggcgatc gtgcgcagcg cccgcgaccg cggcctcacc      1260
     gtgcccgcgg ccaccgggtt caccagctct cccgccgtgg gcgtgacggc tgtcgtggac      1320
     ggcgcgacga tccgcgtcgg cgggccgaac ctcctggcgg aggagaacgt tcgcgaactg      1380
     cccgccgccg acgcctggcg cgagcgcggc gcgatcatcc tgcacgtgct gcgcgacggt      1440
     gccgtgatcg gtgcgctcgc cctcgccgac gaggtgcgcc cggaatcccg cgaggcggtg      1500
     gatgcattgc acgccctggg aatccaggtg gtgatgatca ccggcgacgc cgaggcggtg      1560
     gcgcacgccg tggccgatga actctgcatc gaccgggtgt acgccggcgt ccgaccggag      1620
     gacaaggccg ccaaggtcgc cgagctgcag ggtgagaccc gcatcgtcgc catggtgggc      1680
     gacggtgtga acgacgcacc cgcactggct caggcgaacg tgggactcgc gatcggcgcg      1740
     ggcaccgacg tcgccatcgc ctcggccggg gtgatcctgg ccggcgacga tcctcggtcg      1800
     gtgctgtcgg tgatcgaact gtcccacgct tcgtaccgga agatgaagca gaacctgtgg      1860
     tgggcagcgg gatacaacct gatctcggtg ccgctggccg ccggcgtgct ggccccgatc      1920
     gggttcgtcc tcccgatgtc ggtgggcgcg atcctgatgt cgttgtccac cgtggtggtt      1980
     gcgctcaacg cgcagctcct gcgccggctc gatctacggc cgcagaccgt gaccgccagg      2040
     atcctgcagc gccgctag                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page