(data stored in ACNUC1104 zone)

EMBL: CP001966.PE35

CP001966.PE35        Location/Qualifiers
FT   CDS_pept        complement(38180..38713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76689"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76689.1"
FT                   /translation="MTAPQIRSETVDWDIWYPDAYEISAEGVRGFARAVRDPHVPFGAR
FT                   GILATDTPVPITLLAGPMFDAAAILVSRAIPNCNLSRIVHAAQQFTTVRPLRIGQRISF
FT                   GARLTSHIVKANTDVIAIEVTAYADDAAHLAALITIAHSATAGPGVDLDAVADQIMLTG
FT                   TGPSDSDAYTATAG"
     gtgaccgcgc cgcagatacg atcggaaacc gtcgattggg acatctggta tcccgatgcc        60
     tacgagatca gcgcggaggg cgtgcgcggg ttcgcccggg ccgttcgcga tccccacgtc       120
     ccgttcggag cccgcggaat cctggccacc gacaccccgg tccccatcac actgctcgcg       180
     ggccccatgt tcgacgcggc cgccatcctc gtgagccggg cgatcccgaa ctgcaatctg       240
     tcccgcatcg tccacgccgc gcagcagttc accacggtcc ggcccctgcg gatcggccag       300
     cggatcagct tcggcgcacg actgacatcg cacatcgtca aggcgaacac cgatgtgatc       360
     gccatcgagg tgaccgccta tgccgacgat gctgcccacc tggccgccct gatcacgatc       420
     gcccattccg ccaccgcggg accaggagtg gatctcgacg cggtggcgga ccagatcatg       480
     ctgaccggga cgggaccgtc cgacagcgac gcctacacgg ccaccgccgg ttga             534
//

If you have problems or comments...

PBIL Back to PBIL home page