(data stored in ACNUC1104 zone)

EMBL: CP001966.PE355

CP001966.PE355       Location/Qualifiers
FT   CDS_pept        complement(383163..383966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0366"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   KEGG: nfa:nfa54840 tRNA (guanine-N(7)-)- methyltransferase;
FT                   PFAM: putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77009"
FT                   /db_xref="GOA:D5URF6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF6"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADG77009.1"
FT                   /translation="MESVPESQDPRAEHRRLYPRVTSFRSRRGALTPSQQRAMDEMWPT
FT                   IGRDIPPARPVDGAPNEDAFPAPSHPLDAPAWFGRTAPLIVEIGCGTGTSTVAMAEAEP
FT                   ERDVLAVEVYLPGIAQLVGGVQRQGLTNVRVVRGDGVAVLEDMIAPGSLEGVRVYFPDP
FT                   WPKARHHKRRLLQPRMFSLIADRLRVGGILHVATDHADYAEAIAEVAPSEPLLRPVELP
FT                   PRLADANLPISVDRPVTKFQDKAAQVGREIHEFVWERVVEEGAHR"
     atggagagcg tgcccgaatc tcaagacccc cgcgccgaac accgtcggct gtacccccgt        60
     gtgaccagtt tccgctctcg ccgtggagcg ttgactccgt cacagcagcg ggcgatggac       120
     gagatgtggc cgacgatcgg gcgcgacatc ccgccggcgc gtcccgtcga cggtgcgccg       180
     aacgaggatg ccttcccggc cccgtcacac ccactcgacg ccccggcctg gttcggccgc       240
     accgcaccgc tcatcgtgga gatcggctgc ggaaccggca cgtcgacggt ggcgatggcc       300
     gaggccgagc cggaacgcga cgtcctggcg gtggaggtgt acctgcccgg gatcgcacag       360
     ttggtcggcg gtgtgcagcg ccagggcctg accaacgtgc gggtggtgcg cggcgacggc       420
     gtcgccgtcc tcgaggacat gatcgcgccg ggctcgctgg aaggcgtgcg ggtgtacttc       480
     ccggacccct ggccgaaggc ccggcaccac aagcgccggc tgctgcaacc gcgcatgttc       540
     tcgctgatcg cggaccggtt gcgggtcgga gggattctgc acgtggccac cgatcatgca       600
     gactatgcgg aggcgatcgc ggaggtcgct ccgagcgagc cgctgttgcg gcccgtggaa       660
     ctacccccgc ggctcgccga cgcgaacctg ccgatcagtg tcgaccggcc ggtcacgaag       720
     ttccaggaca aggccgcgca ggtgggccgt gagatccacg agttcgtctg ggaacgggtc       780
     gtggaggaag gagcgcaccg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page