(data stored in ACNUC1104 zone)

EMBL: CP001966.PE358

CP001966.PE358       Location/Qualifiers
FT   CDS_pept        386360..387073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77012"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF9"
FT                   /inference="similar to AA sequence:KEGG:nfa54810"
FT                   /protein_id="ADG77012.1"
FT                   /translation="MGDLTVRGGPPRVRLLGRDGVGKSVLAAALERRGIATTKRDSGDA
FT                   NLYCLAGGLRATDRAAIATLAAGRTPLLVAWTKADAAGSWRAADARAAELAGELGRPVL
FT                   AVMALLDVIGTDELDIARRLAASAFALPESVAEAAAALGDDASVLVRTGGYGLACAIGA
FT                   LRETPSLSTDELLPRLHELSGVDLLAEPVIAAFAGFEARREAEFDETLRTVARTDCARR
FT                   DEAEHLLLDRLARVS"
     atgggggatc tcactgtgcg gggcggcccg ccacgggtgc ggctgctggg ccgtgacggc        60
     gtgggcaagt cggtactggc cgcggccctg gagcgccgcg gcatagcgac gacgaagcgc       120
     gacagcggcg acgcgaacct ctactgcctg gccggcgggc tgcgcgccac cgaccgggcg       180
     gcgatcgcga cgctcgccgc cggccgaaca cccctgctgg tggcctggac gaaggccgat       240
     gcggcgggct cctggcgggc ggccgacgcg cgcgccgccg agctcgccgg tgagctgggc       300
     cggcccgttc tcgcggtgat ggcgctgctc gacgtgatcg gtaccgacga gctggacatc       360
     gcgcgccggc tcgccgcgtc cgcgttcgcg ctgcccgagt cggtcgccga ggccgcggcg       420
     gcgctcggcg acgatgcctc ggtgctggtg cggaccggcg ggtacggtct ggcctgcgcg       480
     atcggtgcgc tgcgcgagac tccgtcgctc tccacggacg agttgctgcc ccggctgcac       540
     gagctcagcg gggtcgacct tctcgccgag ccggtgatcg ccgccttcgc gggattcgaa       600
     gcgcgacggg aggccgagtt cgatgagacg ctgcgcaccg tcgcccggac cgactgtgcg       660
     cggcgcgacg aggccgaaca cctgctgctc gatcgcttgg cgcgggtctc atga             714
//

If you have problems or comments...

PBIL Back to PBIL home page