(data stored in ACNUC1104 zone)

EMBL: CP001966.PE359

CP001966.PE359       Location/Qualifiers
FT   CDS_pept        387070..388110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_52280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77013"
FT                   /db_xref="GOA:D5URG0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77013.1"
FT                   /translation="MTVLVAAQDAAGAIAVARALDGAPAVVGADGALTPLAEQPREVDA
FT                   AVYVLDACVPADPVDSVALGRLRARWGTVVAATGAEAYPDSAATCAESARRLGVAVLPV
FT                   EPGLAAIRAALACAPAPEPCVPAVPARPNPALERADRSAYLRSTVARMRAALLAESAER
FT                   FRGRDDDASPERVRARLERTVAGLELSLHEYLRAAYRGTFAGWPSPPEPAVPVLSRPDP
FT                   TEPPAHRRRPEDAAVLVLGASAGLGIGRAVAAPLEALGTLRWLALPISLVVGLAAALWL
FT                   LRVRRRTSARASRRAWSDGAAAAHRQRVEYEIAAALVAAESDAALRLARGPGTEPRPDA
FT                   SNGHGA"
     atgacggtgc tggtggcggc gcaggacgcg gccggtgcga tcgcggtggc gcgagctctg        60
     gacggggccc cggcggtggt cggcgcggac ggcgcgctga ccccgctcgc ggagcagcct       120
     cgggaggtgg acgccgcggt ctacgtcctc gatgcctgtg tgcccgcgga cccggtcgat       180
     tcggtcgcgc tggggagact gcgggcacgc tggggcaccg tggtcgccgc gaccggtgcc       240
     gaggcgtatc cggatagcgc cgcgacctgt gcggagtcgg cgcggcggct gggcgtcgcc       300
     gtgctgcccg tcgaaccggg gttggcggcg atccgtgccg cgctggcgtg cgcgcccgct       360
     ccggagccgt gcgttcccgc ggtcccggcg cgaccgaatc cggcgttgga gcgggccgat       420
     cgctcggcgt acctgaggtc cacggtcgcg cggatgcggg ctgcgctgct cgccgagtcc       480
     gccgagcggt tccgcgggcg ggacgacgac gcgagcccgg agcgggtgcg ggcgcggctc       540
     gagcggaccg tggctggcct ggaactgtcg ctgcacgagt acctccgggc cgcctatcgg       600
     ggtaccttcg cgggctggcc gtcgccgccg gagcccgccg tgccggtgct ctcccgtccg       660
     gacccgacgg agccgccggc gcaccgtcgg cggcccgagg acgcggccgt actggtgctg       720
     ggtgcctcgg ccggactcgg aatcggccgg gcggtggccg cgccgctgga ggcgctcggc       780
     acgctgcgct ggctggcatt gccgatcagt ttggtcgtgg gcctcgcggc ggcgttgtgg       840
     ctgctgcgag tgcgtcgccg gaccagcgct cgggcctctc gccgcgcctg gtccgacggt       900
     gccgcggcgg cgcaccggca gcgtgtcgag tacgagatcg cggcggcatt ggtggcggcc       960
     gagtccgatg ccgcgctccg gctcgcccgc ggtccgggaa ccgaaccgcg acctgatgcg      1020
     tccaatggtc atggagcctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page