(data stored in ACNUC1104 zone)

EMBL: CP001966.PE36

CP001966.PE36        Location/Qualifiers
FT   CDS_pept        38890..39852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0036"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mpa:MAP0135 CmaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76690"
FT                   /db_xref="GOA:D5UPS2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS2"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG76690.1"
FT                   /translation="MPNLDPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLE
FT                   EAQLAKVDLSLGKLDLKPGMTLLDVGCGWGTTLIRALEKYDVNVIGLTLSKNQYEAVSR
FT                   RLGEVQSERSAEVRLQGWEEFDGAVDAIVSIGAFEHFTHERHLAFFDRAFDILPAGGRA
FT                   MIHTIMTFGMDTFRGESRVTRADFDFFRFIRTEIFPGGELPITKYFPLLAEMGGFDVTR
FT                   IQSLQPHYAKTLDIWAANLEAAREQALHIHPQSVYDTYIKYLTGCADAFRRGLIDVRQH
FT                   TLVKPEHDARHRTLDEVLAMHPEVDAAAGTTAARFIPSR"
     atgccgaacc tcgatccgca cttcgacgac gtccaagcgc actacgattt gtccgacgac        60
     ttcttccgcc tattcctgga cccgacgcag acgtactcgt gcgcgtactt cgagcgcgac       120
     gatatgacgc tggaggaggc gcagctcgcc aaggtggatc tctccctcgg caaactggat       180
     ctcaagcccg gcatgacgct gctggacgtg gggtgcggct ggggaaccac actgatccgc       240
     gccctcgaga agtacgacgt caacgtgatc ggcctgacgc tgtcgaagaa ccagtacgag       300
     gcggtcagcc gcaggctcgg cgaggtgcag tccgagcgtt cggcggaagt ccgcttgcag       360
     ggctgggagg agttcgacgg tgccgtggac gcgatcgtca gcatcggcgc gttcgagcat       420
     ttcacccacg agcggcacct cgcattcttc gaccgcgcct tcgacatcct cccggccgga       480
     ggccgggcca tgatccacac gatcatgacc ttcggtatgg acaccttccg gggcgagagt       540
     cgggtgaccc gtgcggattt cgacttcttc cggttcatcc ggaccgagat cttccccggc       600
     ggggaactgc cgatcaccaa gtacttcccg ctcctcgcgg agatgggtgg gttcgacgtg       660
     acccggattc agagcctgca gccgcactac gcgaagacct tggacatctg ggcggcgaac       720
     ctcgaggcgg cacgcgagca ggcactgcac atccacccgc agtccgtgta cgacacgtac       780
     atcaagtacc tgaccggatg cgccgatgcg ttccggcgcg gcctcatcga cgtgcgtcag       840
     cacaccttgg tcaagccgga gcacgatgcc cggcacagga ccctcgacga ggtgctggcc       900
     atgcatccgg aggtcgacgc ggccgcgggt accaccgcgg cgcggttcat cccctcgcgc       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page