(data stored in ACNUC1104 zone)

EMBL: CP001966.PE363

CP001966.PE363       Location/Qualifiers
FT   CDS_pept        392525..393835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0375"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: msm:MSMEG_1682 flavin-containing monooxygenase
FT                   FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77017"
FT                   /db_xref="GOA:D5URG4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG4"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1682"
FT                   /protein_id="ADG77017.1"
FT                   /translation="MSDTEVEALVIGAGQAGIAMSEHLGAHEIPHLVVERDRIAERWHS
FT                   WRWDSMVANGPAWHDRFPGLEFDIRPDDFAGKRQVADYLCAYAEMINAPIRTGVEVTSV
FT                   TKCTGRAGFRVDTSQGVIHARYVISATGAFQKPVIPAILPQHARIHQIHSVDYRNPQQL
FT                   PGGAVLVIGAGSSGVQIADELRSSGRRVFLSVGPHDRPPRRYRGRDFCWWLGVLGQWDA
FT                   ATPPAGAEHVTIAVSGANGGRTVDFRALAADGITLLGRAERFERGALRFSDDLRANIEA
FT                   GDASYLSMLDEADDYVLRNGLDLPEDPQARTSLPDPECMLDPVREVDLAAEDIRSVVWA
FT                   TGFANDFGWLKVDVFDDRGRPEHQRGVCTEPGIYFLGLPWLSRRGSSFIWGVWHDARHL
FT                   ADQIAIQQGYLRYTGSECARSERGADRNDRSAQGARP"
     atgtcggaca cggaagtcga ggccctcgtc atcggcgccg gccaagccgg tatcgcgatg        60
     agtgagcatc tcggcgcgca cgaaataccc cacctcgtcg tggagcgtga tcgcatcgcc       120
     gagcgctggc attcctggcg gtgggattcg atggtcgcca atggacccgc ctggcacgac       180
     cgattccctg gcctcgaatt cgatatccgg ccagatgatt tcgcgggaaa gaggcaagtg       240
     gcggattacc tctgcgccta cgctgagatg atcaatgccc cgatccggac cggtgtcgag       300
     gtcacgtctg tgacgaagtg cactgggaga gctgggtttc gggtagacac ctcgcagggt       360
     gtgatccacg cccgatacgt gatatcggcg acgggagcat tccagaagcc agtgataccg       420
     gccatccttc cccagcacgc acgcattcat cagatccact cggtcgacta tcgcaacccg       480
     cagcaacttc caggaggcgc ggtactggtg atcggtgccg gatcgtcggg ggtccagatc       540
     gctgacgaac tgcgcagttc cgggaggaga gtattcctgt cggtggggcc gcacgatcgt       600
     ccaccgcgcc gataccgcgg acgggacttc tgttggtggt tgggagtcct cggtcaatgg       660
     gatgctgcta cgccacctgc cggtgctgaa catgtgacga tcgccgtcag cggggcgaac       720
     gggggacgca cagtcgactt ccgcgcactc gccgccgacg gcatcacgtt gctcggacgc       780
     gcagagcgtt tcgagcgtgg tgcgttgcgt ttctcggatg atcttcgagc gaacatcgaa       840
     gcaggcgatg ccagctatct atcgatgctc gatgaagccg acgactacgt tctgcggaac       900
     gggctcgatc tgccagaaga cccgcaggcc aggacttccc tcccggaccc ggaatgcatg       960
     ctcgatccgg tgcgagaagt ggatcttgcc gcggaggaca ttcgatcggt ggtgtgggca      1020
     acgggcttcg cgaatgactt cggttggctc aaggtggacg tattcgacga tcgcggtcga      1080
     cccgagcacc agcgaggtgt ctgcactgag ccggggatct acttcctcgg acttccttgg      1140
     ctttcacggc gtggttccag cttcatctgg ggcgtgtggc acgacgccag acaccttgcg      1200
     gaccagatcg ccatccagca ggggtatctg cgatacaccg gttcggagtg tgcgcgcagt      1260
     gagcggggcg cagaccggaa cgaccgatcc gctcaaggag cccgaccatg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page